KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0579Help
Entry
DIP0579           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(547039..547425)
Genome map
AA seq 128 aa AA seqDB search
MNFDWQMPRDPFADDPNDPASFIEDDEQAPPLTEAERQHIREDLALVKRFKEALEPRGIN
GIFFLCEDCDEDHYYDWDIMAANMRATLAGELAPVHEPSVNPNPHAYVPWDYCLGYLDGL
EAPRMRFF
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttgattggcaaatgccccgcgatcctttcgccgacgatcccaatgatccggcg
tcgtttatcgaagatgacgaacaagcccctccccttaccgaggctgaacgtcaacacatc
agagaagaccttgcgctggtcaagcgctttaaagaggccttagagccccgcggaattaat
ggaatctttttcctctgcgaggactgcgacgaggatcattactacgactgggacatcatg
gctgccaatatgcgagccaccctcgccggtgagctcgcccccgtacatgagcctagtgtg
aatcccaacccacatgcttatgttccttgggattactgcttgggataccttgatggttta
gaagccccgcgcatgcgctttttctaa

DBGET integrated database retrieval system