KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0581Help
Entry
DIP0581           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DIP0581
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     DIP0581
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DIP0581
  Exosomal proteins of breast cancer cells
   DIP0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
549130..550275
Genome map
AA seq 381 aa AA seqDB search
MRDYVEIGMGREARRTYHLDSVAIVPSRRTRSSKDVDTTWHIDAYTFDIPFMSHPTDALA
TPDFVIEMDKQGGLGVINAEGLWGRHADLDAAIQEVITAYGDDELDLGSCNRATKKLQEL
HAAALDTELLVERIAQVRSSGATVAVRVSPQHCHELAPILIKAGAELLIVQGTIISAEHV
ETNGEPLNLKEFIGSIDVPVIAGGVNDYTTALHLMRAGAVGIIAGGGQNTNDCALGIDDS
LATIIADVAAARRDYLDETGGRYVHVIADGQIFTSGDAVKAIACGADAVILGEPLARAAE
AGGKGLYWPSAAAHPRFPRGVVGTAGVMPKTEQVSLEVLLHGPSTNVFGEENFVGGLKRA
MAKCGYTDLKSFQKVDLTVQF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgattacgtcgaaattggaatgggtcgcgaggcccgccgtacctaccacctcgac
agcgttgctatcgtgccgtcacgacgcacccgctcgtccaaggacgtagacaccacctgg
cacatcgatgcctacaccttcgacatcccgttcatgtcacaccccaccgatgctctggca
accccagacttcgtgatcgagatggacaagcagggtgggctcggcgtgatcaacgcggaa
ggcctctggggtcgccacgctgacctcgacgcagcaatccaagaagtcatcaccgcctac
ggcgacgacgaactcgacctcggatcatgcaaccgtgccaccaaaaagctccaagaactc
catgctgctgcactcgacaccgaacttctcgtcgagcgcatcgcacaagttcgctcatcg
ggcgcaaccgtggcagtacgtgtatcgccacagcattgccacgaacttgctcccatcctg
atcaaagcaggtgctgagctcctcatcgtgcagggcaccatcatctccgctgagcacgtg
gaaaccaacggtgaaccactcaacctcaaggaattcatcggctccattgatgttccagtc
atcgccggtggtgttaacgattacaccacggcactgcatctcatgcgcgccggtgccgta
ggcatcattgccggcggtgggcaaaatactaacgattgtgcgctaggaatcgacgattct
ctcgcaacaattatcgccgacgttgctgccgcgcgccgggattacttggatgaaaccggt
ggacgctacgtgcacgtgatcgcagacggtcaaatcttcacctccggtgacgctgtcaag
gcgattgcatgtggtgccgacgctgtgatcttgggtgagccactagctcgtgctgccgaa
gctggcggcaagggactgtactggccatctgctgcggcacaccctcgattccctcgtggc
gtggtcggcaccgctggtgtcatgccgaaaactgagcaagtgagcttggaagtgttgcta
cacggcccatctacaaatgtgttcggcgaagagaatttcgtcggcggcctcaaacgtgcg
atggctaagtgtggctacactgacttgaagagcttccaaaaagtggatctgacagttcag
ttctaa

DBGET integrated database retrieval system