KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0585Help
Entry
DIP0585           CDS       T00151                                 

Definition
(GenBank) Putative iron transport system ATP-binding protein
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    DIP0585
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     DIP0585
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    DIP0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
553311..554123
Genome map
AA seq 270 aa AA seqDB search
MDRNSTATMPQQSLGCMSMSAGYGAELIVRDVSLDVPAGKITALIGPNGSGKSTLLKVLG
RQLRAESGQVTLDGRDIADFGAREFARNLAFLPQQPVVPDGMTVRELISFGRYPYSGAFA
SLSAADHAAIERAAAATSITEFLDADAMALSGGQKQRMWIAVTLAQETGILLLDEPTTFL
DPAHQLAILDLVHELNQQGRTIVMVLHDMAHAAKYSDHVVVMKNGEVLQQGPTQSTLNSG
LIEQAFGISTMMVTDPETNRQLPIAYGIKR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtaattccacagcaacaatgccgcaacagtccttgggctgtatgtcgatgtct
gcagggtacggggcagaattgattgttcgagatgtttcgctcgacgttccagcgggcaag
attaccgcgttgatcgggccaaacggtagcggaaagtcgaccctgctgaaggtgcttggc
aggcagctgcgtgcagaaagcggccaggtgacgttggatggccgagatattgcggatttt
ggtgcgcgggagttcgcacggaatcttgcattccttccgcaacagccggtggtaccagac
ggcatgacggtgcgtgagcttatttcttttggacgctatccatattcgggcgcgtttgcg
tcgttaagcgcggcagatcatgctgccattgagcgggctgctgcggcgacgagtatcact
gagtttttggacgccgatgccatggcattgtccggtgggcaaaaacaacgcatgtggatc
gcggtcacgctggcgcaagaaaccggaattttgcttctcgacgaacccacgaccttcctt
gatcctgcgcatcaattggcgattcttgatctggttcatgagctgaatcagcaaggccgc
acgattgtgatggtgttgcatgatatggcgcatgcggcaaagtattccgaccatgtggtg
gtgatgaaaaatggggaagttttgcagcaagggccaacgcagtcaacgttgaattctggg
ctgattgagcaggcttttggtatttctaccatgatggtgaccgatccagagacgaatcgc
caacttccgattgcctatggcatcaaacgatag

DBGET integrated database retrieval system