KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0586Help
Entry
DIP0586           CDS       T00151                                 

Definition
(GenBank) Putative siderophore biosynthesis related protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
554145..557468
Genome map
AA seq 1107 aa AA seqDB search
MLENGYISQSNCESDIRGRLLAALIDEHLITPETHHKLTNTTTPPADLLRQLAQDNQLTI
TPTNLERACAEIADSVVGLHRARTAITQRWEQALNAQTATNTSQTPYSDLIQALRQRCRL
EDRGSSAMLARCEQLVCDGHPAHPAAKTSLGIGDSFLHVLPEQTETIQLRFVAVDTDHAV
VVGGHPVETISEAMPLLGARLNAELERCELHHHSVIPVHPFQWDNVISSEFAEEIASGTI
VLLETTATAEPLMSVRTLRVSDATGSMHIKVALEIQLTGAVRGVSAGAVAAPAIASIIDD
ACTLDAGFIPRTDTDQPAFSVAYDRSAIRWNADSGIRAHCFGAVLRDDPTGNADDEIAMP
VATLLARNPLTGATIAADLIDELSHRHNRHRDEIATDWFTALGKFLFVPAVALIARWGIA
LEPHPQNTVIILRDGMPHRIVVRDLGGCRLWANGPLAAHPIVDKLRATALIENDLIRLID
KVFYPLVANLHRNLITAAAITKPAQQRINLALSTHIAREYWRTTASHLHPANTVATVFQR
ILGPVLPVKRVLGMRLSGAVTEQEYVADISPLENLELLTPESLRAACAPYSEWAHETLAT
RLHDAAVRERIDDSFPTLRDDIANAEENLALVRAQVTSRVNTPESYWDLLKGLPPHAAMI
AADSYAISGHNVHPLAKLRRGFSIEESAAYGPEAGMSTDLRLVGVDKRMIDTSTTADCVR
LIAHHFPQHIAYARTHLHEHGLDADSYAIIPVHPWQLEHVIREAFAEDIADHTMVPIPNI
AIAAHPTISLRTLVPHAPTPSGTRPFIKCAVDVTLTSTRRSISQDSALGTPRVAGLVATA
LEQLRRETNVQPRAVVVPELSGLALSRDERSEGIDDSFRKTRQRGLSVLLRDDATAYLAP
GEIAMSACALRGHEGVVPSPLRDINEEFFDDYVYDLMSTVLGLMMVKGIALEQHLQNTLV
RIDLSGKTPVYRGIMLRDFSGLRAWAPRLQQWASDQVFEPGAITLTDDHEEFVNKGFYAS
VFGNLDGIVDEYSQARGVDAQSLWERVHVQINRFVQEAAGMLPAVDMEWMRRETIRRKGF
VSMSLQGSSADIYVEERNPLAANPAWA
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaaatggttatatatcccagagtaattgtgaatccgacatccgcggtcgcctc
ctagccgcactcattgacgaacacctgatcacccctgagacacaccacaaactcaccaac
accacaaccccgccagccgacctgcttcgtcaactagcgcaggacaaccagctgaccatc
acgcccaccaacctcgaacgtgcctgcgccgaaatcgccgacagcgtggtgggtctccac
cgcgcacgcaccgctatcacacaacgctgggaacaagcgctgaatgcacaaaccgcaacc
aatacatcccagactccctacagcgacctcatccaagccctgcgacagcgttgccgacta
gaagaccgcggatcgtctgccatgttggcacgctgcgaacaactcgtctgcgacgggcat
cctgcacatcctgcggctaagacttcgttaggaatcggcgattctttcctacacgtcctc
ccagaacaaacagaaacgatccagctacgcttcgtcgccgtcgacaccgaccatgccgtc
gtcgtaggaggacacccagtagaaaccatcagtgaagccatgccgctattgggcgcgcga
ctaaacgctgagctagagcgttgtgaattacaccatcacagcgtcatccccgtgcaccca
ttccaatgggacaacgtgattagcagcgaatttgctgaagaaatcgcctctggaacgatc
gtgctcctcgaaacgactgccaccgcagaacccctcatgtccgtgcgcacactgcgtgtc
agtgacgctactggttccatgcacatcaaagtggcgctcgaaatccagctcaccggcgca
gtgcgaggggtatcggcaggagccgtcgcagcgcccgccatcgccagcattatcgacgac
gcctgcaccctcgacgccgggttcattccccgaaccgacaccgaccaaccagcatttagc
gttgcctatgaccgcagcgccattcgctggaatgccgacagcggaatccgcgcccactgt
tttggcgccgtgcttcgcgacgacccgacaggaaacgcagatgacgagatcgcgatgccc
gtcgcaacgctgctagcacgcaacccactcaccggcgccaccatcgcagcagacctcatc
gacgaactcagccaccgccacaaccgccaccgcgacgaaatcgccaccgactggtttacc
gcactcggaaagttcctattcgtcccagccgtagccctcatcgcacgatgggggatagcc
ctcgaaccacacccccaaaacaccgtcatcattcttcgcgacggcatgccccaccgcatc
gtcgtccgtgacctaggcggctgtcgactctgggcaaacggaccccttgccgcgcacccc
atcgtcgacaagctgcgcgccaccgcactgatagaaaacgacctcattcgactcatcgac
aaagtcttctatccactcgtagccaacctacaccgcaacctcatcacagccgctgctata
accaaaccagcccagcagcgcattaacctcgcactctcaacacacatcgcccgagaatat
tggcgtaccaccgcctcccacctgcacccagccaacacggtcgccaccgtcttccaacgc
atcttagggcccgttttgccagttaaacgagtcctcggcatgcggctatcgggagctgtc
accgaacaagaatatgtagcagacatcagccccctcgaaaacctcgaattactcacacca
gagtccctccgcgccgcatgcgcaccatactccgagtgggcccacgaaaccttagcgacc
cgactccacgatgctgctgttagggaaagaatcgacgattccttcccaacccttcgagac
gacatcgccaatgcggaagaaaacctagccctcgttcgtgcccaagtcacctcccgtgtg
aacaccccagaaagctactgggatcttctcaagggcctaccaccacacgcagccatgatc
gccgccgactcctacgccatcagcggtcacaacgtacaccccctcgcaaaactacggcgc
ggattcagcatcgaagaatccgcagcttacgggcccgaagctggcatgagtaccgacctg
cgtctggtgggcgtcgataagcgaatgatcgacacctccaccacagccgactgtgtccga
ctgatcgcccaccacttcccacagcacatcgcatacgcgcgtactcacctgcacgaacac
ggactcgacgcagattcctacgccatcatccccgtgcacccctggcaactagaacatgtc
atccgcgaagcatttgccgaggacattgctgaccacacgatggtgccgattcccaatatc
gccatcgccgcacatcccaccatctcgttgcgcaccttagttccgcatgcacctaccccc
agcgggactcgaccctttatcaagtgcgctgtcgatgtcacgttgacctccacacgacgc
tcgatctcccaagacagcgcactcggcacgccccgagttgctggcctagttgccactgca
ttggaacaacttcgtagagaaaccaatgtgcaaccgcgcgcagtggtggtcccagaattg
agcggattagcccttagccgcgatgaaaggtcggaaggaatcgacgattccttccgaaaa
acacgccaaagagggctctcggtgctcctgcgtgacgacgccacagcgtatctcgcgccg
ggcgagatcgcgatgagcgcgtgtgcattgcgcgggcatgaaggtgtggtcccaagtccg
ctgcgcgatattaatgaggagtttttcgacgactatgtgtacgacctgatgtcgacagtc
ctcggactcatgatggtgaaaggcattgcgttggagcagcacctgcaaaatacgctggtg
cgcattgacctcagcggtaagacaccggtgtatcgcggcataatgctgcgcgacttttcg
ggcttgcgggcgtgggctcctcggctacagcagtgggccagtgatcaggtttttgaaccc
ggcgcgatcacgttgactgatgaccatgaggagtttgtgaataagggcttttatgcgtcg
gtgtttggcaaccttgacggcattgtcgacgaatattcccaggcgcggggtgtggatgcg
cagagtttgtgggagcgggtgcatgtgcagatcaatcggtttgtgcaggaggctgcgggg
atgttgccggctgtggatatggagtggatgcggcgagaaacgatccggcgtaaggggttt
gtgtcgatgagtttgcaggggtctagtgcggatatttatgtagaggagcgtaatccgttg
gcggctaatcctgcgtgggcctag

DBGET integrated database retrieval system