KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0593Help
Entry
DIP0593           CDS       T00151                                 

Definition
(GenBank) Putative secreted protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
561256..561825
Genome map
AA seq 189 aa AA seqDB search
MSFGMRTASIAFSLALALPMSMMSAPKAQAFPDFPISLEQETSYAVTNSNDCSELHNDEP
VAVPYAAVAAVEELIDNGIIDPSVVFALNNTDPNVTVVGPQPRALPAVAALALAGVAWCA
KGALSSLVPSALQAMVPQANSNVPLSDRVLNALFGCAEGPVLGAVSSQVMRLKFAGAVLA
AVIKLRNFG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgggatgcgcacagcatctattgctttcagtctggcgctagctcttccaatg
tctatgatgtcagccccgaaagcacaggcatttccagatttcccaatctcactagagcag
gaaacaagctacgcagtcactaactctaatgactgttccgaattacacaacgatgagcca
gtagctgtgccatatgcggcagtggctgctgtagaagagctcattgacaacggcatcatt
gatcctagcgttgttttcgctctgaacaacaccgacccgaatgttactgtcgttggaccg
cagcctcgagcattgcccgcagttgcagcacttgctcttgctggagtcgcgtggtgtgct
aagggtgcgttgtcaagtctcgttccttcagcgttgcaagcaatggtgcctcaagctaat
tcgaacgttccgctatctgatcgggttttgaatgctctcttcggctgcgctgaaggccct
gtattgggtgcggttagcagtcaggtgatgcgcctaaagttcgcaggtgccgtccttgct
gctgttattaagttgaggaattttgggtag

DBGET integrated database retrieval system