KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0594Help
Entry
DIP0594           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
562125..562346
Genome map
AA seq 73 aa AA seqDB search
MRNNRNNTQLGRPISPLRTQRHTPATMAATAALSTSPRSQNNLPDTTPLVFLEVGIRDAS
EFYSPITITGHVG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaataacaggaataacacccagctgggtcgtccgatctcgcccctgcgcacccaa
cgacacacgccagcaaccatggcggcaaccgccgcattatcgacgtcaccccgcagccaa
aacaacctccccgacaccacgccactggtgtttctagaagtaggaatccgcgatgccagc
gagttctactcgccgattacaattaccggccatgttgggtag

DBGET integrated database retrieval system