KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0595Help
Entry
DIP0595           CDS       T00151                                 

Gene name
guaA
Definition
(GenBank) GMP synthase [glutamine-hydrolysing]
  KO
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DIP0595 (guaA)
Enzymes [BR:cdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     DIP0595 (guaA)
Peptidases [BR:cdi01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   DIP0595 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
562428..564005
Genome map
AA seq 525 aa AA seqDB search
MTQQTSQKHNPVLVVDFGAQYAQLIARRVREANIYSEVVPHTATVEEIKAKNPAALILSG
GPSSVYADGAPSLDPQVLELGIPVFGICYGFQAMTHALGGTVANTGNREYGRTEMTVDGG
ILHADLEETHKVWMSHGDAVSVAPEGFVVTAHSEGAPVAAFECAEKRMAGVQYHPEVLHS
PHGQEVMVRFLTEIAGLEQNWTAANIAEELIDAVCAQVGPEGRAICGLSGGVDSAVAAAL
VQRAIGDRLTCVFVDHGLLRAGEREQVQTDFVAATGAKLVTVDEREAFLNKLAGVTEPEA
KRKAIGAEFIRSFERAVAGILDDAPEGSTVDFLVQGTLYPDVVESGGGSGTANIKSHHNV
GGLPDDVEFQLVEPLRLLFKDEVRAVGRELGLPEEIVNRQPFPGPGLGIRIIGEVTEERL
ETLRAADLIARTELTAAGLDSEIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDA
MTADWTRLPYDVLEKISTRITNEVSDVNRVVLDCTSKPPGTIEWE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcaaacttcccaaaaacacaatccagtcttggttgtagactttggcgcgcaa
tacgcccagctgatcgctcggcgcgtgcgcgaagccaacatctactccgaggtcgtcccg
cataccgccacggttgaagagatcaaggccaaaaacccggcggcgttaatcctgtccggt
ggcccatcatcggtttacgccgacggcgcaccatcgcttgacccacaggttctcgaactc
ggcatccccgtcttcggcatctgctacggcttccaagctatgacccacgccctaggcggc
accgtggccaacaccggcaaccgtgaatacggtcgcaccgaaatgaccgtcgatggcggc
attctccacgctgacctcgaagaaacccacaaagtatggatgagccacggtgacgctgtc
tccgttgcaccagagggattcgttgtcaccgcccactccgaaggtgcacccgtcgcagcc
ttcgaatgcgccgaaaagcgcatggcaggcgtgcaataccacccagaggttctgcactcg
ccacacggccaagaagtcatggtgcgcttcctcaccgagatcgccggccttgagcaaaac
tggaccgcagccaacatcgccgaagagcttatcgacgcagtctgcgcacaggtcggacca
gaaggccgcgctatctgtggtctttccggtggtgttgactctgcagtcgcagcagcactc
gtccagcgcgccatcggcgaccgcctcacctgcgtattcgtcgaccatggcttgctgcgt
gcaggcgaacgcgaacaggtccaaaccgatttcgtcgccgcaaccggcgcaaaactcgtc
accgttgacgagcgcgaagcattcctgaacaagctcgcaggtgtcaccgaaccagaagct
aagcgcaaagccatcggcgcagaattcatccgctccttcgaacgcgcagtcgccggcatt
ctcgacgacgcccccgaaggctccaccgtggactttctcgtccaaggcaccctctaccca
gacgttgtagaatccggcggcggctctggtaccgccaacatcaagagccaccacaacgtg
ggcggcctgcccgacgacgtagaattccaactcgtcgaaccactacgcttactgttcaaa
gacgaagtacgcgcagtgggtcgcgaactcggtctgcctgaagaaatcgtcaaccgccag
cccttcccaggccccggcctcggcatccgcatcatcggcgaagtcaccgaagagcgcctg
gaaacactacgcgcagccgacctcatcgcccgcaccgagctgaccgcagctggcctcgac
agcgaaatctggcagtgcccagtagttttgcttgccgacgtccgctccgtcggcgtccaa
ggcgacggccgcacttacggacatcccatcgtcctacgccccgtctcctccgaagacgcc
atgaccgcagactggacccgactgccctacgacgtgctcgagaaaatctccacacgtatc
accaacgaggtctcagacgtcaaccgcgtcgtcctcgactgcacctccaagccaccagga
accatcgagtgggaataa

DBGET integrated database retrieval system