KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0599Help
Entry
DIP0599           CDS       T00151                                 

Definition
(GenBank) Putative two component system sensor kinase
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC HATPase_c HATPase_c_2 Peptidase_U4 HisKA_3 SPC25 Trp_oprn_chp 7tm_3 GAPT
Motif
Other DBs
NCBI-ProteinID: CAE49116
UniProt: Q6NJ17
Position
566547..567758
Genome map
AA seq 403 aa AA seqDB search
MPVATAHATIIHMQPAFPRYYRDRSHGIVAGVAAGLASYLGVKVVTVRWVLALLSFVNGI
GILFYVAVWLFIPTRPESEDNAGTTHNADTTIYTDQSSSATLTNWLLVFAAFAGAVLTGR
IANSFLGISTPLLLSLTICAIGIVLSWIAYDRFNSKYSIVIIAVGTVFVFTGIVLATVEW
GGDSGFGVALLAVALTLLGVSALAVPFGLQMWRRYTEESRQRAAADERAEIAARIHDSVL
QTLALIQKRSTEAGVQKLARFQERELRQWLFAPRDNVSFFAAIERACGEVEDMFGVTVHP
VTVGEDRIIDHNTQAAVFAAREAMVNAAKHAGVPSIDVYAECFDNVEIYVRDRGPGFDLD
AIAEDRHGVRDSIIARVQRCGGEAQITSNNGTEVVIRMPFDGQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtggccacggcacatgcaacaataatccacatgcagccagcttttccccgttat
taccgcgaccgctcccacggcatagtcgccggtgtcgcagcaggactcgccagctatcta
ggcgtcaaagttgtgacagtgcgatgggttctcgcactgttatcttttgttaacggaatc
ggcatcctcttttacgtcgccgtgtggcttttcatcccgacgcgtccggaatcggaagat
aacgctggcactacccataatgcggacaccacaatatatacagatcaaagctcatcagcc
acgctgaccaactggcttctagtcttcgctgcgttcgcaggtgcggtgttgacgggaaga
atcgccaattctttcctaggaatttccacgccgttgctgctttccctaaccatttgtgcc
atcggcattgtgctgtcgtggatcgcatacgaccgctttaattccaaatattcgattgtc
attattgctgtgggaacagtttttgtttttaccggcatcgttctcgccaccgtggaatgg
ggtggcgatagtggcttcggggtagcactgcttgctgttgcgcttactcttttaggggtt
tccgcgttggctgtaccgtttggcttgcagatgtggcgtcgttacacagaagaaagccga
caacgcgcggcagcagatgaacgtgcggagattgcggcaagaattcacgattccgtcctg
caaacactggcgttgattcaaaagcgttccaccgaagcgggggtacaaaaacttgcgcgc
ttccaagaacgggaattacggcaatggctttttgctcctcgtgataatgtctcgtttttc
gccgcgattgaacgggcttgtggagaggtcgaagacatgtttggcgtgactgttcatcct
gtcacggtgggcgaagatcgcattattgaccacaacacgcaagctgcagtttttgctgct
cgagaggcgatggtcaatgctgccaagcatgcaggagttcctagtatcgacgtctatgcc
gagtgttttgacaacgtggaaatctatgtgcgtgaccgaggtcctgggttcgatttggat
gcaattgctgaagaccgtcacggtgtgcgtgattccattatcgctcgagtgcaacgctgt
ggcggtgaagcacaaatcacctccaataacggcacggaagtcgtgattcgaatgcctttt
gacggacaatag

DBGET integrated database retrieval system