KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0603Help
Entry
DIP0603           CDS       T00151                                 

Definition
(GenBank) Hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
569646..570416
Genome map
AA seq 256 aa AA seqDB search
MTGCSHRFYYSHMIQTSVRSFEVGEDLASMAVDERISLLRSRMQSISKSGDFSLDYNCKT
ADKNIIPLSDPLSHVLPWGGLPRGMIVESTITPLLAILFIAQVSGSGRRVGVVGWPDLNY
AGVLGYGGCYERIFAVPQQERTSLRVVTALAHGCDLVITRAGPTPRTYTPLQTQRFRNSL
RSDAGCVIMMGDHVVSPAARLASAVVGYHGIGKGTGRIKAVEITVTGIAKGFYRTSRVIV
GKHIAPAAEKTTMKVV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgacggggtgttcacataggttctattatagccacatgattcaaacgagtgttcgatct
tttgaggtgggggaggatcttgcctccatggctgttgatgagcggatttctttacttcgt
tcgcgcatgcaatccatatccaaaagtggggatttttctttagattataattgtaaaact
gcagataaaaacattattccgttatctgatccactgtcccacgtgttgccgtggggtggg
ctgcctcgggggatgattgtagagtctactattaccccattacttgctattttatttatc
gcgcaagtgagcggttctggtagaagggtgggtgttgtgggctggccagatcttaactat
gcgggtgtgctgggatacggaggttgctatgagcggatttttgctgttccccagcaagaa
cgcacctcattacgtgttgttacagcccttgcacacggatgcgatcttgtgatcacacgt
gcagggcctactcctaggacgtacacgccgctccaaactcaacgatttcgtaattcttta
cgatcagatgctggctgcgtgatcatgatgggagatcatgtcgtttcacctgcagcgcgt
ttagcttccgcggtggtgggataccacgggattgggaaagggacggggcgtattaaggct
gtagaaatcaccgtaactggcatagccaagggtttttatcgaacttcgagagtcatagtc
ggcaagcacatagctcctgctgctgagaaaacaacgatgaaagtggtctaa

DBGET integrated database retrieval system