KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0610Help
Entry
DIP0610           CDS       T00151                                 

Definition
(GenBank) Putative ABC transport system secreted protein
  KO
K02073  
D-methionine transport system substrate-binding protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    DIP0610
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    DIP0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(576948..577820)
Genome map
AA seq 290 aa AA seqDB search
MNFTKFRTALSILSVTVVAATGLVACSGGSSDANTIKIGTTDSTKKAWDVWKDKAKEQGI
DLEVVDFSDFSTPNQALSQNRLDVNLFQHLKFLAEYNVKSKSDLVPVGSTEIIPLALFWK
GHDSLDGIEGQSVAIPNDPTNQARAINVLVANKLITLKTPGMSTPTPADVDTAKSKVTLT
PVEAASAPAAYGEGKPAIINNTFLERSGIDAKTAVIQDDPASTEAEPYINVMVTTKENKD
NPRWAQLIELWHTDEVQKALAEDSKGTSVEVKRSPEELQAILDRLEAEVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcacgaaattccggacagcattgtcgattctttccgtaactgtcgttgcagcg
accggtttggttgcgtgctcgggcggttcttccgatgccaacaccatcaaaattggtact
acggactctacaaagaaggcgtgggatgtatggaaagacaaggcgaaggaacagggcatc
gacttggaggtcgtggacttttctgatttctccacgccgaaccaggcactgtcgcaaaac
cgactcgatgtgaacttgttccagcatttgaaattccttgcggaatataacgtgaagtcc
aagtccgatttggtccccgtgggatcgacggagatcattccgttggcgttgttctggaag
ggtcacgattctcttgacggtattgaggggcaatcggtggcgatccctaacgatcccacg
aaccaagctcgtgccatcaatgttctagtggctaacaaactgatcacgttaaagacccct
gggatgagtactcctaccccagcggacgtcgatacggcgaagtcgaaggtgacgctcacg
cctgttgaggcggcgtcggcgcctgcggcatatggtgagggcaagccagcaattattaac
aacacgttcttggagcggtccggcattgatgccaagactgcggtcatccaagatgatccc
gcatctacggaggccgagccttacattaacgtcatggtgaccaccaaggagaacaaagat
aatcctcggtgggctcagctcattgagttgtggcataccgatgaggtgcaaaaagctctc
gcggaggattctaaaggtacctctgtggaagtaaagcgtagccccgaagagcttcaggcc
atcctggatcgcctcgaggctgaggtgaagtag

DBGET integrated database retrieval system