KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0612Help
Entry
DIP0612           CDS       T00151                                 

Definition
(GenBank) Putative DNA polymerase
  KO
K14162  
error-prone DNA polymerase [EC:2.7.7.7]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DIP0612
DNA repair and recombination proteins [BR:cdi03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    DIP0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
579083..582202
Genome map
AA seq 1039 aa AA seqDB search
MVDWVSGVNGKPLKWSQLEGVLSGTYPQEFKLANVGGSGSGSEKIRYYSSQPFAELHAAS
YYHFLHGANSPQDMVAAACQQGMSALALIDRDGFYGAMEFAEAAATSGLPTVFGAELTLA
PDRILTVLARGVEGYTSLSRLITQARMRGSKDVTIYPPLAEIVESMGKNCRFLLNHSWCT
DESLLEIFYPDTVVLEYGVTMRPEDVDHHELLDSIRQRYGFMAIASAVPSAVDRVSARVA
GAKQALAQRESLPQATPRLHPMGSTWMRGGDELAGSVDKQLLDASVEVARDCAFALDLVA
PNLPRWPVPDEMAHLTGLVNARFDARYRGRSEDVKNQARAQIHHELAVIKELGFPGYFLI
VDDIVSFCHTNNILCQGRGSAANSVVCFVLGITNVEPISTGLLFERFLSRDREGPPDIDI
DIESGRRDAVITYVYDTYGRDNAAQVANVITYRTKAALRDAARALGYPNTSADAWSTNPD
EAPNAVRFLAEQLKGQPRHLGIHAGGMVICDRPIADVVPTEWARKHGRSVVQWDKESCAS
AGLVKFDLLGLGMLEALHHMIDLVVETTGTTINLWEIDLAEPEIYTMLSNGDAVGVFQVE
SRAQLATLPRLRPREFFDLVVEVALVRPGPIQGGSVHPYIRRRNGLEAVTYEHPILERSL
RKTLGVPLFQEQLMHIAVDAAGFSGGEADELRRAMGSRRSVDTMNRMKRRFFAGLRRNNI
TGDIAGILWNKIVAFVAYGFPESHSQSFASLVYFSAWFKYHHPAEFYVGLLRAQPMGFYS
PQSLLADARRKELTILSHNINKSQVEATVENGAIRLGLNMIKGVGKTEAEAIVAHAPYRD
IADLSRRAGLGVAVIEALARSGALETLGVGRRQALWQAGAAATEKAAMLPGLSMVSAPSL
PGMNAFELIVADIAMTGVSSENPVALLRRQLELRGVIPASELLNCENARRILLAGVVTHR
QRPQTAAGVTFLGLEDETGLANVVVSVGLWKRSRAVKVARAVLVRGVVHNADGVASVTAD
RVEELPFAEMMSAGSRDFR
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggtggattgggtatctggcgtcaatggaaaacctcttaaatggtcgcaattagaaggt
gttttatcgggaacatatccccaagagttcaagctggcgaatgtcgggggtagtgggagt
ggtagtgaaaagattcgatattattcatcgcaaccattcgctgaactccatgcagcgagt
tattaccatttcctccatggtgctaattcaccacaagacatggttgctgcggcatgccag
caaggcatgagtgccttagcgcttatcgaccgtgacggtttttatggggcaatggaattt
gccgaggctgcggccactagtggtttgcccacggtctttggtgcagaactaactcttgcc
cctgatcgaattttgactgttttagcacgtggagtggaaggctataccagcttatcccgc
ctcataacccaagcgcgtatgcggggtagtaaagatgtcactatctacccgccactggct
gagattgttgaaagtatgggaaagaattgccgattccttctcaaccattcatggtgcact
gacgaatcactgctagaaatattctatcccgacaccgtggttttggaatacggcgtgacc
atgcgacccgaggacgtagatcaccacgaactacttgatagcattcggcaacgctacgga
tttatggcgatcgcgagcgcagtgccgagcgcagtcgatcgagtatccgcgcgtgtcgct
ggggcgaaacaagccttagcgcagcgggaatcattgccacaagctacaccgcgtctgcat
ccgatgggaagcacatggatgcgaggcggggatgagttggcgggaagcgtcgataagcaa
ctgcttgacgcttctgttgaggtggcccgtgactgtgcctttgcgctcgatttggtggcg
ccgaaccttccacgctggcctgtccccgatgagatggctcaccttactgggctggtgaac
gcgcgtttcgacgcacgctaccgtgggcgaagcgaagacgttaaaaaccaggcgcgggct
caaattcaccacgagttagctgttattaaagaactaggatttcctggatacttcctcatc
gtcgacgatatcgtaagcttctgccacacaaacaacatcttgtgccagggtagggggtct
gcggccaactctgtcgtctgttttgtccttggcatcactaatgttgaaccgatcagcacc
ggtttactcttcgaacgatttctctcccgcgatcgcgaaggccccccagatattgatatt
gacattgaatcggggcgtcgcgacgccgtcatcacctacgtgtacgacacctatggtcgc
gataacgcagctcaagtagccaatgtgatcacctaccgcactaaagcagcgcttcgcgac
gccgcccgcgcccttggctaccccaacaccagcgccgacgcctggtccaccaaccccgac
gaagcccccaacgcagtgcgattccttgcagaacaactcaaagggcaacctcgacaccta
ggaatccacgcgggaggaatggtgatctgcgaccgacccatcgcagatgttgttcccacg
gaatgggctagaaaacacggccgcagtgtcgtccaatgggacaaagaaagctgcgcgagt
gcagggctcgtcaaatttgatctactcggactcggcatgctcgaagcgcttcatcacatg
atcgaccttgttgtggaaaccaccggaacgaccattaacctctgggaaatcgaccttgct
gaacccgaaatctacaccatgctcagcaacggtgatgccgtcggagtattccaagtcgaa
tccagagcacaactagccacactgcctaggcttcggcccagagaattcttcgacctcgtt
gtcgaagtagccctcgtgcgcccaggccccatccaaggcggatccgttcacccctacatc
cgcagacgaaatggtctcgaagcagtcacctacgagcatccgattctcgaacgtagcctg
cgcaaaacccttggagttccgctttttcaagaacaactcatgcacatagctgtcgacgct
gcaggttttagtggtggtgaagccgacgaactgcgccgtgcaatgggctctcggcgatcc
gttgacacgatgaacagaatgaaacggcgattctttgcgggattacgaagaaacaacatt
acaggcgatattgcaggcatcttatggaacaaaatcgttgcctttgtcgcctacggattt
ccggaatcccactcgcaatcttttgcctcgctagtgtatttctccgcatggtttaaatac
catcatcccgccgaattttatgtgggactgcttcgtgctcaaccgatgggcttttactcg
ccacagtcgttattagccgatgctcgtaggaaggaattgacgattctttcccacaacatc
aataaatctcaggtagaagccaccgtagaaaacggggctattcgcttaggactgaacatg
attaaaggagtagggaaaacagaggcagaggcaatcgtggcccatgcgccttatcgggac
attgctgatttgtcgcgcagggcaggattgggggtagctgtgattgaagcattggcgcga
tctggagcattggaaacgctaggggtggggcgtcgacaagcgttgtggcaggcgggggcg
gcggcaacagagaaggctgctatgttgccggggttgtcgatggtatctgccccctcatta
cctgggatgaatgcgtttgagctgatagtggcagatattgcgatgacgggggtgagcagt
gagaatccagtggcgttgttgcgtcgtcagttagaacttcgtggtgtgatacccgcatcg
gaattgctgaactgtgagaatgctcgtcggatccttctcgcgggagtagttacacaccgg
cagcgtccgcagacggctgcgggtgtcacatttttgggattagaagatgagacaggtttg
gccaatgtggtcgtctcagttggcttgtggaagcggagccgtgctgtaaaagtggcgcgg
gcggtacttgttcgtggggtggtgcacaatgcggatggggtggcgtcggtgacggctgat
cgcgtggaggagttgcctttcgcggagatgatgagtgctgggtcacgagacttccgctag

DBGET integrated database retrieval system