KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0613Help
Entry
DIP0613           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
  KO
K09167  
uncharacterized protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
582222..582692
Genome map
AA seq 156 aa AA seqDB search
MMLMGSTMNAVSPKLVKARYWAVVPFLVVTILGSAASAVFLWSWMWIVTGVWVAILAWAV
WLIPAQVRRIGWREDPDELLITKGKLWRTLTVVPYGRLQFVDVQEGPIARRCGLAEVEIH
TASSTSDASIAGLPVADAYALRQRLTDKARERLSGL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttatgggtagcacaatgaatgcggtgtcgccaaagctggtgaaagctcgatat
tgggcagtggtgccttttctcgttgtgacgatactaggaagcgctgcgtccgctgtcttt
ttgtggtcatggatgtggatcgtcacaggggtgtgggtggcgattttggcgtgggctgta
tggctgattccagcacaggtgcgcaggatagggtggcgcgaagatcccgacgaactgctg
attacgaagggtaaattgtggcgaactctcaccgtggttccttatgggcgtttgcagttc
gtggacgttcaagaagggcctattgcgaggcgttgtggtcttgcagaagtagagatccac
acggcatcgtcgacaagcgatgccagcatcgcgggtcttccggtcgcggacgcgtatgcg
ttgcgtcagcgactaaccgataaagcgcgcgagaggcttagcgggctatga

DBGET integrated database retrieval system