KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0617Help
Entry
DIP0617           CDS       T00151                                 

Definition
(GenBank) Putative ABC transport system membrane protein
  KO
K02075  
zinc/manganese transport system permease protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Module
Putative zinc/manganese transport system
Brite
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative zinc/manganese transporter [MD:M00244]
    DIP0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
585906..586739
Genome map
AA seq 277 aa AA seqDB search
MLIELSEITGIAPYLLRPLILLTVLGFVSGLVGVVVNLRSLEFNAEAVVHSVFPGIVAGA
VFGGIDMIIPAASTVAALVAIALTFASRHSEAGTAVVLTSFFSVGIVLSLKKGDMSGQLE
ALMFGRLLEVTDERLIQALIVCAIAVAVMLWTWRTHIFVAFDREGARATGVNLLTIDLAI
NVAIAAVVVASSTAIGTLLVIGYLCIPGAAARLIATRVHTMVPLAMAFGIVGGYLGVWLS
GLSPRVSPQASVALSVVAMYGVGLIIYRLRGSVGRRS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgagctttctgagatcacaggaattgcgccgtatctgcttcggccacttatc
ttgctcaccgtactcggttttgtttctggacttgtcggagtcgtggtaaacctgcgctct
ttggaattcaatgccgaagcggtagtccactcagttttcccagggattgttgcaggggca
gtttttggtggaatcgacatgattatccctgctgcatcgaccgtcgccgcgcttgttgct
attgcgttgacttttgcttcgcgccactcggaagccggtacggctgtggtcttgacgtcg
tttttttcggtaggaatcgtcttgtctctcaaaaagggagacatgtctgggcaattagaa
gcattgatgtttggacgtcttttggaagttaccgatgaacggttgattcaagctctcatt
gtgtgcgcgattgctgtggccgttatgttatggacgtggcgaactcatatcttcgttgcc
ttcgatagggaaggcgctcgcgcgacgggtgttaaccttttaaccatcgatcttgcgatt
aacgttgcgattgctgcggttgtggtggcgtcgtcgactgcaatcggcacactactagta
atcggatatctgtgtattcctggtgctgcggcacgattgatcgctacccgtgtgcatacc
atggtgcctcttgccatggcttttggaattgtgggtggttatctcggggtgtggttgtca
ggtctatcgccacgtgtttctccgcaagcatcagtcgcgcttagcgtggtcgctatgtac
ggcgtgggccttatcatctatcgtctgcgtggttcggttgggagaagatcatga

DBGET integrated database retrieval system