KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0619Help
Entry
DIP0619           CDS       T00151                                 

Definition
(GenBank) Putative diphtheria toxin repressor 2
  KO
K03709  
DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Transcription factors [BR:cdi03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DIP0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
587557..588171
Genome map
AA seq 204 aa AA seqDB search
MHEATGKPVSLGELASRMSQKTPTASEAVKKLVARGLLDHERYGGIMLTEQGEALAKQMV
RRHRLVEMFLFETLGFGWDEVHEEAEILEHAMTDKLLQRIDDHLGNPSRDPHGDPIPSEE
GIVDSVPIHQLGEFAVGEEVIIERIHDRDANLLRYLAEHGVLPGVRVIIGEPAYPGMNIV
KVGDRDIPLAESSLWAINARKIDS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggctactggcaagcccgtctccctcggcgagttagcgtcccgaatgtctcaa
aaaactcccaccgcatctgaagctgttaaaaaacttgttgctcgtggtctgctcgatcat
gaacgctatggcggaatcatgctcactgagcagggcgaagccttggctaaacagatggtg
cgtcgtcatcgtcttgtggaaatgtttctttttgaaaccctaggttttgggtgggatgaa
gtccatgaggaagccgagattcttgagcacgcgatgacggacaagcttcttcagcgtatc
gacgatcaccttggtaacccgtctcgtgacccacatggagatccaatcccatctgaagaa
ggaatcgtcgattctgtcccgattcatcagcttggtgagtttgcggttggagaagaagtc
ataatcgagcgaatccatgatcgcgatgccaacctgctgcgctatttagccgagcacgga
gtattgccaggtgttcgtgtcattattggtgaacctgcttacccaggtatgaatattgtg
aaggtaggcgacagagacatcccactcgcagaaagtagtttgtgggctataaacgctcgc
aaaatagattcttag

DBGET integrated database retrieval system