KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0620Help
Entry
DIP0620           CDS       T00151                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase
  KO
K01491  
methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DIP0620 (folD)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     DIP0620 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     DIP0620 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
588393..589238
Genome map
AA seq 281 aa AA seqDB search
MSAIKLDGNLYRDEIFEDLKGRVNSLREKGIVPGLATVLVGDDPASHAYVRMKHKDCEIV
GVKSIRKDLPADVTQEELLAVIDDLNADPECTGYIVQLPLPKHLDENAVLERIDPAKDAD
GLHPVNLGKLVLNEPAPLPCTPNGAIHLLRRFGVELDGKKVVVIGRGVTVGRPIGLMLTR
RSENSTVTLCHTGTRDLAAETREADVIVAAAGKAHMLTADMVKQGAAILDVGVSRVDGKL
LGDVHPDVWDVAGAVSPNPGGVGPLTRAFLIRNVVERAERA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctatcaaacttgacggaaacttgtatcgcgacgaaatcttcgaagatcttaaa
ggacgtgtcaattctctccgagagaaggggatcgtgccaggtcttgcgactgttcttgtc
ggcgatgaccctgccagccacgcctatgtccgtatgaagcacaaggattgtgaaattgtt
ggtgtgaagtcgatccgtaaggatcttcccgctgatgtgactcaagaagagctgttagct
gttattgatgatctaaatgctgatcctgagtgcactggctacattgtgcagctcccattg
ccaaagcacttggatgagaatgcggtgctagagcgcattgatcctgcgaaagacgccgat
ggtttgcacccagtgaatctgggtaaattggttttgaatgagcctgctccgttgccatgt
acccctaatggtgcaattcatctgttgcgtcgttttggagttgagctagatggcaaaaaa
gtagttgtaattggacgtggtgtgactgttgggcgtcctattggtttgatgttgacgcgg
agaagtgagaactctaccgttacgctgtgtcatacgggtactcgtgatcttgctgcggag
actcgtgaagctgatgtcattgttgctgctgcgggtaaagcgcacatgctaacggctgat
atggtcaaacagggtgctgcgattcttgatgtgggagtatcgcgtgttgacggcaaactg
cttggcgacgttcaccctgatgtctgggatgttgcaggtgcagtttctccaaatcctggt
ggggttggaccgctgactcgcgctttcttgattcgtaacgtagtagagcgtgctgagcgt
gcctag

DBGET integrated database retrieval system