KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0623Help
Entry
DIP0623           CDS       T00151                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  
homoserine O-acetyltransferase [EC:2.3.1.31]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DIP0623 (metX)
Enzymes [BR:cdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DIP0623 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(591014..592117)
Genome map
AA seq 367 aa AA seqDB search
MLTTTGTLTHQKIGDFYTEAGATLHDVTIAYQAWGHYTGTNLIVLEHALTGDSNAISWWD
GLIGPGKALDTNRYCILCTNVLGGCKGSTGPSSPHPDGKPWGSRFPALSIRDLVNAEKQL
FDHLGINKIHAIIGGSMGGARTLEWAALHPHMMTTGFVIAVSARASAWQIGIQTAQISAI
ELDPHWNGGDYYSGHAPWEGIAAARRIAHLTYRGELEIDERFGTSAQHGENPLGPFRDPH
QRFAVTSYLQHQGIKLAQRFDAGSYVVLTEALNRHDIGRGRGGLNKALSAITVPIMIAGV
DTDILYPYHQQEHLSRNLGNLLAMAKISSPVGHDAFLTEFRQMERILRHFMELSEGIDDS
FRTKLER
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaccacagggacgctcacgcaccaaaaaatcggagacttttacaccgaagcc
ggagcgacgcttcacgacgtaaccatcgcctaccaagcatggggccactacaccggcacc
aatctcatcgttctcgaacatgccctgaccggcgactctaacgctatttcatggtgggac
ggactgattggccctggcaaagcactcgacaccaaccgctactgcatcctatgcaccaac
gtgctcggaggatgcaaaggatccaccggaccgagcagtccacacccagacggaaaacca
tggggatccagatttccagccctttcaatccgtgaccttgtcaatgccgaaaaacaactt
ttcgaccacctcggcatcaataaaattcacgcaatcatcggcggatccatgggaggcgca
cgcaccctcgaatgggctgcactccacccacacatgatgacgactggattcgtcatagca
gtctcagcacgcgcaagcgcttggcaaatcggtattcaaactgcacaaatcagcgccata
gaactcgacccccactggaacggcggcgattactacagcggtcacgcaccatgggaagga
atcgccgccgctcgccggatcgcccacctcacctatcgcggcgaactagaaatagacgaa
cgattcggcacttccgcacaacacggtgaaaacccactcggccccttccgagatccacat
caacgttttgcggtcacgagctacctccaacaccaaggcatcaaactcgctcaacgattc
gatgcaggtagttacgtcgtgcttaccgaagccctcaatcgtcatgacatcggacgcggc
cgaggcggactcaacaaagccctcagcgcaatcacagtccccatcatgattgctggcgtt
gataccgatattctctacccctatcaccagcaagaacacctatcacgaaatctaggcaac
ctactcgctatggcaaaaatcagctcaccagtaggccacgacgctttcctcacagaattc
cgacaaatggagcgaatcctaagacatttcatggagctttcggaaggaatcgacgattcc
ttccgaaccaaactagagcgctga

DBGET integrated database retrieval system