KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0626Help
Entry
DIP0626           CDS       T00151                                 

Gene name
hmuT
Definition
(GenBank) Iron-related transport system receptor precursor protein
  KO
K02016  
iron complex transport system substrate-binding protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    DIP0626 (hmuT)
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    DIP0626 (hmuT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
594730..595791
Genome map
AA seq 353 aa AA seqDB search
MKSLLRACMSVVCACALVGCGVQGTYDSTKDLRESLPKAGDVKDPRSFTGVSDVRDFDDV
RPVSESVSPSLPVHLTDADGFDVEVTDVSRIIALDIYGTYTKTLEGLGLADKIVGRTVSS
TENVLKDVPVVTEGGHNINVEAVLSLHPSLLIVDHSIGPRDAIDQIRNAGVTTVVMEPTR
TIDSVAEDIKTLGSVVGLSDEASILAERSVHEISAAREAIAAIAPSDPMRVAFLYARGNG
GVFFIMGEGTGAKDLIEGVGAKDMGAEYKLSYAEPANAEALAKINPEAIIMMTAGLESTG
GIDGLLARPGVAQTIAGKNRRVITIPDGQSLAFGPMTGQTLLRTAQALYDPQV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctttgcttcgtgcttgtatgtccgtggtgtgtgcgtgtgcactggtgggttgt
ggtgtccagggcacatatgattcgacgaaggatctccgagagtcattgcctaaggctggt
gacgtcaaggatccgcgttcttttacaggtgtgtctgatgtgcgcgattttgatgatgtg
cggcctgtttcggaatctgtgagcccttcgttgcctgtacatctcacggacgctgatggt
tttgatgttgaggttacggatgtttctcgcattattgccttggatatttatggcacgtat
acgaagactttggaaggcttggggctcgctgacaaaattgttggcaggactgtgtcgtcg
acagagaacgtgcttaaagatgttcctgttgtgaccgagggtggccataatatcaatgtt
gaggccgtgttgagtctgcatccgtcattgttgatcgttgatcactcgattggtccgcgt
gatgcgattgatcagattcgcaatgctggcgttactactgtggtgatggagccaactcgt
acgattgattctgtcgcggaggacatcaagacgttgggtagcgtagtcgggcttagcgac
gaggcgtcgattcttgccgaacgtagtgttcatgaaatttctgcggctcgtgaggcgatt
gctgcgatcgctccttctgatcccatgcgcgtggcatttttgtatgcgcgtggtaacggt
ggtgttttcttcattatgggtgaaggaactggggctaaagatttgattgagggcgttggc
gcgaaggacatgggcgctgaatacaagctttcttatgctgagcctgcaaacgctgaggct
ttggcaaagattaatcctgaggcgatcatcatgatgacagctggtttggaatcgactggt
ggaattgatggtttattggcacgaccaggtgtggcgcagacgattgctggaaagaatcgt
cgagtcattacgatccctgatggacaatctttggcgttcggtccgatgactggtcagacg
cttcttcgcacggcacaggctttgtatgacccacaggtatag

DBGET integrated database retrieval system