KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0627Help
Entry
DIP0627           CDS       T00151                                 

Gene name
hmuU
Definition
(GenBank) Iron-related transport system membrane protein
  KO
K02015  
iron complex transport system permease protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    DIP0627 (hmuU)
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    DIP0627 (hmuU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
595775..596827
Genome map
AA seq 350 aa AA seqDB search
MTHRYSKRSDDVFVLRARRRVMLFVVLVVLVLASVITSLALGQYYVPLRDLLTILTQPDS
SSLMHNVIWEIRLPRIVLGLLVGACLGVAGTLMQAVFANPLAEPSIIGVTSGAGVGAAAV
IVFNVGILGTFTVPAAAFLSAVVVTVIIYQLARHQGKVAIVNLILTGIAINAVCNALISF
LVYLAPTSNREEIVFWQMGSLNGAQWKHVWVVAPIALVGIVISSQIGKQLDVLALGERAA
GHTGINVGRLRIIAIAASTILTAAAVSFAGLIGFVGLIVPHLLRSISGPENRLLLPASAL
AGAVLIACADVAARTMIPFADLPIGIFTALVGGPTFFVLLRRMLKKGSVH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacccacaggtatagcaagcgtagcgacgacgtgttcgttcttcgggcacgtcgtcga
gtgatgttgtttgttgtcttagtggtgttggtgttggcgtcagttattacgtcgttggcg
ttggggcagtactatgttccgcttcgcgacttattgacgattcttactcagcctgattca
agcagtttgatgcacaacgttatttgggagatccgtcttcctcgaattgtgttgggtttg
ttggttggtgcatgccttggtgtggctggcactctgatgcaagccgtttttgcgaatccg
cttgcggagccgtcgattatcggagttacttctggagccggtgtgggtgcagcagcggtg
atcgtattcaacgtgggaattttgggtacttttactgttcctgcggcagcatttttgagt
gcggttgttgtgacggtgattatctatcagctggctcgacatcaaggtaaggttgcgatc
gtcaatttaattttgactggtattgccatcaatgccgtgtgtaatgcattgatttctttt
cttgtgtaccttgctcctacgtcgaatcgtgaagagattgttttttggcagatgggatcg
cttaatggagcacagtggaaacacgtctgggtagttgcccctattgcactggtaggaatc
gtcatttcttcccaaatcggtaaacaactagatgtgctagctcttggcgaacgcgcggca
gggcacacgggtatcaatgttggacgattgcgcattattgctattgctgcctcgacgatt
ttgactgcagcggctgtgtcgtttgctggattgattggttttgttggtttgattgttcct
cacttgctgcggagtatttctggcccagagaatcgtctactccttccagcatctgcgttg
gcaggagcggtattgatcgcgtgcgcggatgttgctgcgcgtacgatgattccgtttgcg
gatttgccgattggtatctttacggcacttgttggtggcccaacattttttgttttgtta
cgtcgaatgttgaagaaaggctctgtccattga

DBGET integrated database retrieval system