KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0630Help
Entry
DIP0630           CDS       T00151                                 

Definition
(GenBank) Putative methionine biosynthesis-related protein
  KO
K01740  
O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DIP0630
Enzymes [BR:cdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     DIP0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(598958..600274)
Genome map
AA seq 438 aa AA seqDB search
MPTKYDNSNANKWGFETRSIHAGQSVDSDTSARNLPIYLTSSYVFNDAEHAANRFNLSDA
GPVYSRLTNPTVAAVEERLANLEGGVHAVLFASGMAAETAAILNIARAGSHIVSSPRIYG
GTETLFAVTLARLGIETTFVENPDDPASWEAAVQDNTVALYGETFANPQADVLDIPAIAE
VAHKHQVPLIVDNTLATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGNFDWTV
TRNGEPIFPDFVTPDPAYHGLKYSDLGAPAFGLKARVGLLRDTGAAPSPLNAWITAQGLD
TLSLRVQRHNENALAVAQFLANHEKVAKVNYAGLPDSPWYPVKEKLGFDYTGSVLSFDVK
GGKNEAWRFIDALKLHSNLANVGDVRSLVVHPATTTHSQSEESALLAAGINQATIRLSVG
IESIDDIIADLTAGFDAI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaaaatacgataattccaatgccaacaaatggggtttcgagactcgctccatc
cacgcaggacaaagcgtcgatagtgataccagtgcccgcaacctaccgatttacctgaca
tcatcgtacgtttttaatgacgccgaacacgcagcaaaccgcttcaacctttccgacgcc
ggcccggtttactctcgcctgaccaacccaactgtcgcggcagtcgaagaacgcctagcc
aatcttgaaggtggcgtacacgccgtacttttcgcttccggaatggccgccgaaaccgcc
gcaatcctcaacatcgcccgcgcgggttcccacatcgtgtccagtcctcgcatttacggc
ggcaccgaaacactctttgccgtcacattggcacgcctgggcatcgaaaccactttcgta
gaaaatcctgacgacccagcctcatgggaggctgcagttcaagacaacacggtagctctc
tacggagaaaccttcgctaatccacaagcagacgtgcttgatattcccgcaatcgcagag
gttgcccataaacatcaagtaccactgatcgtcgacaacaccctcgcaaccgcagccctt
gtacgccccctcgaactcggtgcagacgtcgtcgtggcatccctaaccaagttctacacc
ggaaatggctccggactcggcggagtgcttatcgacggcggaaacttcgactggaccgtc
acacgcaacggcgaaccgatcttccccgactttgtcaccccagatcccgcctatcacggt
ctcaagtattccgatcttggtgcccccgccttcggactaaaggctcgcgtcggactcctg
cgcgacaccggcgcagccccatcaccactcaacgcatggatcaccgcacaagggctcgac
accctctcgctacgagtacaacgccacaacgaaaacgcactcgcagtagcacaattcctc
gccaaccacgagaaagtagccaaggttaactacgcaggccttcccgactccccttggtac
ccagtcaaagaaaaactcggattcgactacaccggctccgtactttcctttgacgttaaa
ggtggaaaaaacgaagcatggcgctttatcgacgcactcaaactacactcgaacctcgcc
aacgtcggagacgtacgttccctcgtagtccacccagcgaccaccacgcactcacaatcg
gaagaatcggcacttctagccgcaggaattaatcaagcaaccatccgactctccgtcggc
atcgaatccatcgacgacatcatcgccgacctcacagcaggtttcgacgcaatctaa

DBGET integrated database retrieval system