KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0632Help
Entry
DIP0632           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
602928..604208
Genome map
AA seq 426 aa AA seqDB search
MGDAHQGNMQTLLRYLVVLVNHLNKRKPVPRQTEITHRHRLIAMLALALGGFGIGVTEFV
SMGLLSLIAEDFNVAESTAGHVITAYAMGVVVGAPVITAFTGMIPRRRLLILLMIAFTIG
NALTVFTTSYPVLMAARFLAGLPHGAFFSVAGLAVASMAPEGQRGRALAFVGMGLPVATV
VGVPAVQALGFATTWKAAYVVVTIIGAITLALLWTLMPHMSKMKPTSPLTELGALKNGQV
WASLLIGSVGFGGMFAVYTYISWTMTQRAGLPEALMWIVLMAYGLGMIAGNFIGGRLSDW
SVEYGILTALICIVLTLVSFYFTSAYAWIAIINFALVGLSGSMLIPSLQIRLMDVAGRAQ
TLAAALNHSALNIANACGALLGGVVISAGYSYSAPALAGAALGCAAIIIWIPAHITRSKQ
ERKQHS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgctcatcagggaaacatgcaaacgctgttaaggtatctcgtcgtgcttgtc
aaccacctcaataaaagaaaacctgtaccccgccaaacagagatcactcatcgccaccga
ctcatcgccatgttggcgttggcgctcggcggatttggtatcggtgttaccgaatttgtc
tccatgggattgctcagccttatcgctgaggacttcaacgtggcggagtccactgccggt
cacgtgattaccgcctatgcgatgggcgtggtcgtcggtgcgcctgtcatcaccgctttt
accggaatgattccgcgccgacgtctactgatcttgttgatgattgcctttacaatcggc
aacgcgttgacagtatttaccacttcttatcctgtgctgatggctgcacgctttttagct
ggcttgccgcatggtgcgtttttctcagtagcgggccttgccgtggcgtcgatggcccct
gaagggcaacgcggccgtgctctcgcttttgtcggcatgggattgcccgtagcgacggtg
gtcggtgtacccgctgtccaagctctgggatttgctaccacgtggaaagccgcgtacgtg
gtggtcaccatcatcggtgctattaccttggcattgttgtggacgctcatgccgcatatg
tccaagatgaaaccgacgagcccactcacagaactcggtgcgttaaagaacggtcaagtt
tgggcgtcactgctgatcggttcggtgggctttggtggcatgtttgctgtgtacacctat
atctcttggacgatgacgcagcgcgcgggtttgcctgaggcgctcatgtggatcgtgctg
atggcctatggacttggcatgattgcgggcaattttatcggcggacgcctctccgactgg
agtgtggaatacggaattcttactgctcttatctgcattgtgctcactttggtgagtttc
tacttcaccagtgcctatgcgtggatcgccatcatcaactttgctctggtggggctttcc
ggttcgatgctcatcccgtctcttcagatccgacttatggacgttgccggtcgtgcccag
accctagctgctgcacttaaccactctgcgcttaacatcgcgaatgcttgtggcgcactg
cttggtggcgtagtgatcagcgcaggatatagctattctgctcctgctcttgcaggcgct
gctttaggttgtgccgccatcatcatttggatcccagcgcatatcacgcgcagcaaacaa
gaacgcaaacagcacagctag

DBGET integrated database retrieval system