KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0634Help
Entry
DIP0634           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
605270..605449
Genome map
AA seq 59 aa AA seqDB search
MRISGIIALVVGIAAVLGGYFLTGNNDVAGMLGGILMGVGGATTIGGLIAIVAPRPRMQ
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatttctggaatcatcgcccttgttgtcggtatcgctgccgtcctaggcggttat
ttcttaaccggtaacaatgacgttgcgggtatgctcggcggcatcctcatgggagtaggc
ggtgccacgaccattggtggcctcatcgctattgtggctccccgccctcgtatgcagtag

DBGET integrated database retrieval system