KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0635Help
Entry
DIP0635           CDS       T00151                                 

Gene name
trpS
Definition
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    DIP0635 (trpS)
Enzymes [BR:cdi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     DIP0635 (trpS)
Amino acid related enzymes [BR:cdi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DIP0635 (trpS)
Transfer RNA biogenesis [BR:cdi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DIP0635 (trpS)
 Prokaryotic Type
    DIP0635 (trpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
605642..606676
Genome map
AA seq 344 aa AA seqDB search
MTATVQENTQKKQRVLSGIQPTADSYHLGNYLGALKQWIELQDNYEAFYFIPDLHAITVD
QDPRELRERTIAGAAQLLALGIDPHKSTLFVQSHVPEHAELGWVLTCLTGFGEASRMTQF
KDKSAKRGADRTSAGLFTYPMLMAADILLYRPQFVPVGEDQRQHLELTRTLAERFNSRFK
KTFVVPDGIIPEGAAKIYDLQDPTSKMSKSGSNPKGLINLLDDPKVSAKRIRSAVTDNDG
EIRFDKENKPGVSNLLVIQSALTGKTIDSLVDAYQGQGYGALKVDTADALEAFVTPLKAQ
YDMYMSDRAELENVLALGAEKAREIASRTLADAYEHIGFLPPKR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccgtgcaagaaaatacgcagaagaagcaacgtgtgctgtcgggaattcaa
ccaacagccgactcgtaccacctaggaaactatttgggtgccctgaagcagtggatcgaa
cttcaggataactacgaggcgttttacttcatccctgatctgcacgccatcacggttgat
caagacccccgtgagctgcgggaacgtaccatcgctggtgctgcacagctcttggctttg
ggtattgatcctcacaagagcactctgtttgtgcagtctcacgtgccggaacacgctgag
cttggttgggttcttacgtgcttgaccggtttcggcgaagcgagccgcatgacacagttc
aaggacaagtccgccaagcgaggtgcggatcgtacctcagcaggtctgttcacttatccc
atgttgatggctgcggatattctgctttaccgtccgcagtttgtgccggtgggcgaggac
caacgccagcacttggagctcactcgcacgcttgctgagcgttttaactcccgttttaaa
aagaccttcgtggtgccagacggaattattcctgagggtgctgccaagatttatgatctt
caagacccaacctccaagatgagcaagtcgggttcgaaccccaagggcttgattaatctg
cttgatgaccccaaggtttctgcgaagcgcattcgctctgctgtgaccgacaacgacggc
gagatccgttttgataaggaaaacaagcctggtgtgtccaacttgctggtcattcagtcg
gcactgacgggcaagaccatcgactcgcttgtcgacgcctaccaaggccagggttacggc
gccttgaaggtcgacaccgccgatgccctcgaggccttcgttacacctttgaaggctcag
tacgacatgtacatgtctgaccgtgctgagctggaaaatgtgttggctcttggcgccgaa
aaagcccgtgagattgcatcgcgcacccttgcggacgcctacgagcacatcggttttttg
ccgccaaagcgctaa

DBGET integrated database retrieval system