KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0637Help
Entry
DIP0637           CDS       T00151                                 

Definition
(GenBank) Putative peptidoglycan synthesis related protein
  KO
K07258  
serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DIP0637
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DIP0637
Peptidases [BR:cdi01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DIP0637
Peptidoglycan biosynthesis and degradation proteins [BR:cdi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DIP0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(608070..609302)
Genome map
AA seq 410 aa AA seqDB search
MKRVPKTLIALTAITATLSPTALSATMAPVLADPAPRSSAPNTDKCDNATTPPSAETTSE
KLAPGRTSIAPLPTVDNEFGSCGITKATGFDVPTNTASAWMVFDLDTGAVIATKDPHGRY
RPASVIKALIALVAIDELDLSKKVTITNDDVNQEGSAVGFVEGIDYSVQQLLDGLLLGSG
NDAASALARALGGEDTTIKKINDLAQELGTVDTYAASYTGLDAQGMSTSVRDLAVIYQAA
WQNPVFADTVKKEYSELPADKTGTTFQVWNDNGILMNTEHGIGGKTGFTDDAHHTFVGAK
NINGRRIAAVILDTTIDLGRPWEQANKLIDAGYKVAENQAVGSILRKESSIPSEESQPKE
LSRPSFTNPSDNRDTTPRFVILGALVALVVLGALAWMFGKREDREDRVDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtgccaaaaaccctcatcgcgctgaccgccatcactgcaacactctcaccc
accgcacttagcgcaaccatggcaccagtattagctgatcccgcaccgcgttcctccgcg
ccgaacaccgacaaatgcgacaacgctaccaccccaccatcggccgagacgacctccgaa
aaactcgcaccaggccgtacttcaatcgcacctcttcccaccgtcgacaacgaatttggc
agctgtgggataacaaaagcaacaggattcgacgtccccaccaataccgcttcggcatgg
atggtttttgacctcgataccggtgctgtcatcgccaccaaagacccccacggacgctac
cgtcctgcatccgtcatcaaagccctcatcgcgctcgtcgcaatcgacgaactcgacctt
tcgaaaaaagtcaccatcaccaatgacgacgtgaaccaagaaggctccgctgtcggattt
gtggaaggaatcgactattccgtccaacaactactcgacggactactcctcggcagcgga
aacgatgccgccagtgcactcgcacgcgccctcggcggcgaagacaccaccatcaaaaag
atcaacgatcttgcgcaggaattgggaaccgtcgacacgtacgccgcctcgtacactggc
ctggatgctcaaggcatgtccacttctgtgcgcgaccttgctgtgatctatcaagcagca
tggcaaaaccccgtcttcgcagacaccgtgaaaaaggaatactcagaactccccgccgat
aaaaccggcacaacattccaagtctggaatgacaacggcatcctcatgaacaccgaacac
ggcatcggcggtaaaaccggctttactgacgacgcccaccacaccttcgtcggcgccaaa
aacatcaacggtcgccgcatcgccgccgtcatcctcgacaccaccatcgacctcggacgt
ccatgggaacaagccaacaagcttatcgacgccggctacaaagtcgccgaaaaccaagca
gtagggtcgattcttcggaaggaatcgtcgattccttccgaagaatcgcaaccaaaagaa
ctctcgcgcccatcgtttactaatccttctgataaccgcgacacgacacctcgttttgtg
attctgggggcgttggtggcgctggtggtgctcggggcactggcatggatgttcggtaaa
cgcgaagatcgtgaagatcgtgtagatcgttaa

DBGET integrated database retrieval system