KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0642Help
Entry
DIP0642           CDS       T00151                                 

Gene name
upp
Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K00761  
uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DIP0642 (upp)
Enzymes [BR:cdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     DIP0642 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
612990..613625
Genome map
AA seq 211 aa AA seqDB search
MEIRIVDHPLAASRLTIMRDKRTNNAGFRAALADLGAMLVYEASRDLAIEQFPVSTPVAD
TQGTRLQDPPIIVPIIRAGLGMVDPALSMIPDAQVGFIGMARDEATHQPVPYLEALPDDL
SGRTVFCVDPMLATGGSLLHAIKLLADRGATDITAICMVSAQEGVDALAESGLPCRLVTA
TIDPELNDDAYIVPGLGDAGDRLYGPRNIDL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcggatcgtcgaccaccccttggcagcttcacgtcttaccatcatgcgcgat
aagcgcactaacaatgcgggattccgtgctgcgcttgcagatctcggcgccatgctcgtg
tatgaggcgtctcgtgatctcgcaattgagcagttcccagtcagcacccctgttgctgat
acgcaggggactcgtttgcaggatcctcccattatcgtgccgatcattcgtgccggtttg
ggcatggtggatccagcgttgtcgatgatccctgatgcccaggtgggctttattggcatg
gcgcgtgatgaggctactcatcagcctgttccttatcttgaagcgttgcccgacgatctc
agcggtcgcaccgtgttctgcgtggatccgatgctagctacggggggttctttgctacac
gccattaagctgctggcggatcgtggcgctaccgatatcaccgctatttgtatggtgtcg
gcgcaggagggtgttgatgccttggctgagtcgggtctgccttgccgtttggtcacggcc
accatcgaccccgagcttaacgacgacgcctacatcgtgcctggcctaggtgatgcgggc
gatcgtctctacgggccacgtaacatcgacctctaa

DBGET integrated database retrieval system