KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0645Help
Entry
DIP0645           CDS       T00151                                 

Gene name
lpdA
Definition
(GenBank) Dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00010  Glycolysis / Gluconeogenesis
cdi00020  Citrate cycle (TCA cycle)
cdi00260  Glycine, serine and threonine metabolism
cdi00280  Valine, leucine and isoleucine degradation
cdi00620  Pyruvate metabolism
cdi00630  Glyoxylate and dicarboxylate metabolism
cdi00640  Propanoate metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
cdi01120  Microbial metabolism in diverse environments
cdi01130  Biosynthesis of antibiotics
cdi01200  Carbon metabolism
Module
cdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DIP0645 (lpdA)
   00020 Citrate cycle (TCA cycle)
    DIP0645 (lpdA)
   00620 Pyruvate metabolism
    DIP0645 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    DIP0645 (lpdA)
   00640 Propanoate metabolism
    DIP0645 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP0645 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    DIP0645 (lpdA)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     DIP0645 (lpdA)
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DIP0645 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like GIDA FAD_oxidored K_oxygenase NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 XdhC_C Trp_halogenase 3HCDH_N DAO Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: CAE49162
UniProt: Q6NIX1
Position
615701..617173
Genome map
AA seq 490 aa AA seqDB search
MGCLRYTWALDSSNRHTHTGGTVTRIVIIGGGPAGYEAALAGAKYGAEITIIEDRGLGGA
AVINDCVPSKSFIAGANIKTDLRRADDMGLNKGIGEAHLLIDALNNRVQALAYEQSSDIR
ASMDAHGVRVIDGRGSFDDYNPKQTVHYIKVDRADGTTETIECDLVLIATGATPRILPDA
QPDGERILTWRQIYGLTELPEHLIVVGSGVTGAEFVSAFAELGVKVTMVASRDRILPHDD
ADAADVLETVLAERGVALEKHARVDSVIRTEDGGVCVKTSDGREIFGSHALMTVGSVPNT
KDLGLEKIGIATTRSGHICVDRVSRTNVAGVYAGGDCTDLFPLASVAAMQGRIAMYHALG
EGVKPIRMKTVATAVFTRPEIAAVGVTQKQIESGEVIARTVMLPLQTNPRAKMRSLRHGF
VKMFCRKNSGIVIGGVVVAPTASELILPIAVAVTNQLTVSDLAESFAVYPSLSGSITEAA
RQLVQHDDLQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgggatgtctccgatacacttgggcgttggactcatctaaccggcacacccatactgga
ggaacagtgactcgaatcgtgattatcggcggcggccccgcaggctatgaagcagcgttg
gccggcgcaaaatatggcgccgaaatcaccattattgaggaccgtggtctaggcggcgca
gcagttatcaacgactgcgtgccatccaagtcgttcatcgccggcgcaaacattaagact
gacttgcgccgcgccgacgacatgggactgaacaaggggatcggcgaagcacacctgctt
atcgacgccctcaacaaccgcgttcaggcccttgcttacgaacaatcctccgatattcgg
gcgtcgatggatgctcacggtgtgcgcgttatcgacggccgcggctcctttgatgattac
aaccccaagcaaaccgtgcactacatcaaggtcgaccgtgctgatggcaccacagaaact
attgagtgcgacctcgttttgattgctactggtgcaaccccacgtatccttcctgacgcg
cagccagacggtgaacgaatcctcacatggcgtcagatctacgggctcaccgaattgcca
gagcacctcattgtggttggctcgggtgtgactggtgctgagtttgtttctgcgttcgca
gagcttggtgtgaaagtgacaatggtcgcttcgcgtgaccgcattttgcctcacgacgac
gccgatgctgccgacgtcctagaaaccgtgctagcagaacgtggcgtggccttggaaaag
catgctcgcgttgattctgttatccgtaccgaggacggcggcgtatgtgtgaagacttcc
gatggtcgagagatcttcggttctcacgccttgatgaccgtcggttctgtgcccaacacc
aaagatcttggtctagaaaaaattggcattgcgacaacacgttcaggccacatttgtgta
gaccgcgtttctcgtaccaatgtcgcaggcgtgtatgcaggtggcgactgtactgatcta
ttcccgctggcgtcagtagcagctatgcaggggcgaattgccatgtaccacgctcttggt
gagggcgtaaagccgattcgcatgaagactgtggctaccgcagtatttacccgtccagaa
attgccgctgtgggtgttacccagaaacaaattgagtctggtgaggtaattgcacgtacg
gtgatgttgccgctgcagaccaacccgcgtgccaagatgcgttcattgcgccacggtttt
gtcaagatgttctgccgtaagaactccggcatcgtgatcggtggcgtggttgttgctcct
actgcctcagaactgattctgccgattgctgttgctgtgacaaaccaactcaccgtgtct
gatctggcggagagctttgccgtctatccatcattatcgggttcgattactgaggctgcg
cgtcaattagtgcagcatgatgacctgcaataa

DBGET integrated database retrieval system