KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0645Help
Entry
DIP0645           CDS       T00151                                 

Gene name
lpdA
Definition
(GenBank) Dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DIP0645 (lpdA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DIP0645 (lpdA)
   00020 Citrate cycle (TCA cycle)
    DIP0645 (lpdA)
   00620 Pyruvate metabolism
    DIP0645 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    DIP0645 (lpdA)
   00640 Propanoate metabolism
    DIP0645 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP0645 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    DIP0645 (lpdA)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     DIP0645 (lpdA)
Exosome [BR:cdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DIP0645 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
615701..617173
Genome map
AA seq 490 aa AA seqDB search
MGCLRYTWALDSSNRHTHTGGTVTRIVIIGGGPAGYEAALAGAKYGAEITIIEDRGLGGA
AVINDCVPSKSFIAGANIKTDLRRADDMGLNKGIGEAHLLIDALNNRVQALAYEQSSDIR
ASMDAHGVRVIDGRGSFDDYNPKQTVHYIKVDRADGTTETIECDLVLIATGATPRILPDA
QPDGERILTWRQIYGLTELPEHLIVVGSGVTGAEFVSAFAELGVKVTMVASRDRILPHDD
ADAADVLETVLAERGVALEKHARVDSVIRTEDGGVCVKTSDGREIFGSHALMTVGSVPNT
KDLGLEKIGIATTRSGHICVDRVSRTNVAGVYAGGDCTDLFPLASVAAMQGRIAMYHALG
EGVKPIRMKTVATAVFTRPEIAAVGVTQKQIESGEVIARTVMLPLQTNPRAKMRSLRHGF
VKMFCRKNSGIVIGGVVVAPTASELILPIAVAVTNQLTVSDLAESFAVYPSLSGSITEAA
RQLVQHDDLQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgggatgtctccgatacacttgggcgttggactcatctaaccggcacacccatactgga
ggaacagtgactcgaatcgtgattatcggcggcggccccgcaggctatgaagcagcgttg
gccggcgcaaaatatggcgccgaaatcaccattattgaggaccgtggtctaggcggcgca
gcagttatcaacgactgcgtgccatccaagtcgttcatcgccggcgcaaacattaagact
gacttgcgccgcgccgacgacatgggactgaacaaggggatcggcgaagcacacctgctt
atcgacgccctcaacaaccgcgttcaggcccttgcttacgaacaatcctccgatattcgg
gcgtcgatggatgctcacggtgtgcgcgttatcgacggccgcggctcctttgatgattac
aaccccaagcaaaccgtgcactacatcaaggtcgaccgtgctgatggcaccacagaaact
attgagtgcgacctcgttttgattgctactggtgcaaccccacgtatccttcctgacgcg
cagccagacggtgaacgaatcctcacatggcgtcagatctacgggctcaccgaattgcca
gagcacctcattgtggttggctcgggtgtgactggtgctgagtttgtttctgcgttcgca
gagcttggtgtgaaagtgacaatggtcgcttcgcgtgaccgcattttgcctcacgacgac
gccgatgctgccgacgtcctagaaaccgtgctagcagaacgtggcgtggccttggaaaag
catgctcgcgttgattctgttatccgtaccgaggacggcggcgtatgtgtgaagacttcc
gatggtcgagagatcttcggttctcacgccttgatgaccgtcggttctgtgcccaacacc
aaagatcttggtctagaaaaaattggcattgcgacaacacgttcaggccacatttgtgta
gaccgcgtttctcgtaccaatgtcgcaggcgtgtatgcaggtggcgactgtactgatcta
ttcccgctggcgtcagtagcagctatgcaggggcgaattgccatgtaccacgctcttggt
gagggcgtaaagccgattcgcatgaagactgtggctaccgcagtatttacccgtccagaa
attgccgctgtgggtgttacccagaaacaaattgagtctggtgaggtaattgcacgtacg
gtgatgttgccgctgcagaccaacccgcgtgccaagatgcgttcattgcgccacggtttt
gtcaagatgttctgccgtaagaactccggcatcgtgatcggtggcgtggttgttgctcct
actgcctcagaactgattctgccgattgctgttgctgtgacaaaccaactcaccgtgtct
gatctggcggagagctttgccgtctatccatcattatcgggttcgattactgaggctgcg
cgtcaattagtgcagcatgatgacctgcaataa

DBGET integrated database retrieval system