KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0653Help
Entry
DIP0653           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(629449..629877)
Genome map
AA seq 142 aa AA seqDB search
MTAFNDMLAPPPVQLPQDPALDGMDLEAVTATTALEHPESPSVWAQLAHKALATAHSDEQ
RAIAYAYARTAYHRSLDRLRANGWKGWGPVPFAHEPNQGVLRAIAALALASQKIGDTAEY
ERCRQMLLDADQSCVDTLLPPA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttttaacgatatgctcgctcccccacccgttcagcttccgcaagacccagcg
cttgacggcatggatctcgaagcagtcactgctacgaccgcccttgagcaccccgaaagc
ccatccgtgtgggcacaacttgcacacaaagcccttgcaacagcgcacagtgacgagcaa
cgggccatcgcctacgcctacgcacgaaccgcctaccaccgcagcctcgatcgtctccgt
gccaacggttggaaaggttgggggccagtgccatttgcacacgagccaaaccaaggcgtg
ctgcgtgctattgccgcgcttgccttagcctcacaaaaaattggcgacactgccgaatac
gagcgatgccgccagatgcttctcgacgccgaccagagctgcgtcgatacgctgcttcca
ccagcctaa

DBGET integrated database retrieval system