KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0655Help
Entry
DIP0655           CDS       T00151                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DIP0655
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DIP0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(630494..631399)
Genome map
AA seq 301 aa AA seqDB search
MSSSMTVVGSINADVSIQVARHPSPGETVLGHDSTISPGGKGANQAVAAALQGASVSFVG
AVGNDTYADHALKILRSSGVNLDAVETIDDNTGVAYIQVSDDGENSIIVIPGANAHVTAD
YVEHHRKPIEDADIVLLQGEIPADGFSAAVQAARGTVVVNLAPVIDVDRDCLLRADPLMA
NEHEAALILEQLGVPVTSEDPRVLIEALRSQGFASVVLTLGGHGALVADASGVTPIATPY
VTAVDTTGAGDAFAGAFVARRLQGDSLIDAATFAARVGAFSVQGRGAQTSYPSESDTLPA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatctatgactgttgttggttcgatcaacgctgacgtcagcatccaagtagca
cgacatcccagcccaggtgaaaccgtcctaggccacgactccaccatcagccccggcggc
aaaggcgcaaaccaagccgttgccgctgcgctccaaggcgcatcagtatctttcgtaggc
gcagtaggaaacgacacctatgccgaccacgcactaaaaatcctgcgatcttccggcgtg
aacttagacgcagtcgaaacaatcgacgacaacaccggcgttgcgtacattcaagtctcc
gacgatggcgaaaacagcatcatcgttattcccggcgcgaacgcgcatgtcaccgcggac
tacgtagagcaccatcgtaaacccattgaggacgccgacatcgtgctcttacagggtgag
attcccgcggatggttttagcgccgcagtgcaggcagctcgaggcaccgtggtagtcaat
cttgcgcctgtgattgatgtcgatcgtgactgtctcctacgcgcggatccgttgatggct
aatgagcatgaggcggcgttgattctagagcaactcggcgttccggtaaccagtgaagat
ccccgcgttctgatcgaggcactgcgttcgcaagggtttgcctccgtggtgttgaccctt
ggtggacatggcgcgctggtcgccgatgcttctggtgtgacgccgattgccaccccatac
gtcacagcagtagacaccacgggtgctggtgacgcattcgcgggggctttcgtggcacgt
cgtttgcaaggagactcgcttatcgacgccgccacgttcgcagcccgtgtcggagcgttc
tccgttcaaggtcgcggggcgcaaacttcttatccttctgagtccgatacgctgcccgcg
gtgtag

DBGET integrated database retrieval system