KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0659Help
Entry
DIP0659           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
635607..636701
Genome map
AA seq 364 aa AA seqDB search
MKSVKLAVVSASTALSVIAVGTAVTGAEEAKVSACAAAENKASVSKENAAAAQANVDKKI
IEITSADPDVIHSMRELEQVKSALEAAKWELGAAEDLNDESKPAGKALQAVLDRKLMNAL
SATSKARQSFKRAELALHQSKENRIQSEINGIGVGINSDERLELENNLDKALRKMSEADE
GLSEALLALTFITQDIIDDKAEVEKSQEKRHEVAGKYIVQAKAAIEAAKPLIEAAETYSK
ISVGNALEAAKQNPEVLKDEEEAKRLNDQAVLDQKAAEECAADEAAKADKNQAETGKDNS
TNGQGRKGVGKEKGENEDQGDGDNNQDSEGNSKFFGILAAVLGGLGLAGLVAYFMPMIMK
FFNR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtcaagcttgcggttgtgtctgcatccaccgcgctatctgtcattgctgta
ggaaccgctgtgactggtgcggaagaggctaaagtttctgcatgtgctgccgctgagaac
aaggcgagtgtttcgaaagaaaatgctgctgcagctcaagcgaatgtagataaaaaaatc
atagaaattacttctgcagatcctgatgttattcattcgatgcgcgaacttgagcaagtg
aaatcagcgcttgaagctgcaaagtgggaattgggtgcagctgaagatctgaatgatgag
tcgaaacctgcggggaaggcactacaagctgtcttggaccggaagctgatgaacgctttg
tctgcaacatctaaagctcgtcaaagtttcaagcgtgctgaattggctctccatcaatct
aaagagaatcggattcagagtgaaattaatggcattggggtaggtattaacagtgacgaa
agacttgaactagaaaataatttagataaagctttgagaaaaatgtcagaagcggatgaa
gggctatctgaggcgctgcttgccctgactttcataacacaggacattattgacgataag
gctgaggtggaaaagtcgcaggaaaaacgtcacgaagttgctggaaagtacattgttcaa
gcgaaggctgcgattgaggctgcaaagcctttgattgaagctgcagaaacctattctaag
atctctgttgggaatgcgcttgaagctgcaaagcagaacccagaggtcttgaaagatgaa
gaagaagctaagaggttgaatgatcaggctgttcttgatcaaaaagctgctgaagaatgt
gcagcggatgaggctgcaaaggccgacaagaaccaagctgaaaccggtaaggataattcc
accaatggccagggtcgaaaaggggtcggcaaggaaaaaggtgaaaacgaggatcaaggc
gatggcgataataatcaggattctgagggcaactccaagttcttcggtattcttgctgca
gttctaggtggccttggtttggctggcttggttgcttacttcatgccaatgatcatgaaa
tttttcaaccgctaa

DBGET integrated database retrieval system