KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0661Help
Entry
DIP0661           CDS       T00151                                 

Definition
(GenBank) Putative biotin synthesis-related regulatory protein
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00780  Biotin metabolism
cdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DIP0661
Enzymes [BR:cdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     DIP0661
Transcription factors [BR:cdi03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DIP0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-ProteinID: CAE49178
UniProt: Q6NIV5
Position
638727..639527
Genome map
AA seq 266 aa AA seqDB search
MSSDSRAPLDIAWLHEQLVENGPYNRLEHTMATGSTNTDLVAAAHAGAPEWTAFLTEHQS
QGRGRMGRKYESPVGAQLTLSVLIRPRKESVSRLGTMPLATGLALVDVLGSDPRIGLKWP
NDLLCDGRKLCGILAEAVSLGDHPAVVIGLGLNTALTKEELPVAHATSLDLEGIAYERNQ
LAVDVLNALYKRLNQWIAGDPSLMGDYRRVCTSIGADVRVVLSEDKELLGVAESVTDEGL
ICVRDASGELHEFMVGDVTHLRLQDK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttctgattcccgcgcccccttggacattgcttggcttcacgaacagctcgttgaa
aacgggccctacaaccgtctcgagcacacgatggcaacgggatcgacaaacacggatctc
gtggcggcagcacatgctggggcaccggaatggacagcatttcttaccgaacaccagtca
caaggtcgcgggcgtatgggtcgcaaatatgaatcacctgtgggcgcacagctcaccctt
tccgttcttatccgtccccgcaaagaatcggtttctcggttaggtaccatgccacttgcc
acaggtctcgcgcttgtcgacgtcctcggctccgatccccgtatcggcctcaaatggccc
aacgacctgctatgcgacggccgcaagctctgcggcattttggcagaagctgtaagcctt
ggtgatcaccctgccgtcgtaattggtttagggcttaataccgcgctgaccaaagaagaa
ctccctgtcgcccacgccaccagccttgatcttgagggcattgcttatgagcgcaaccag
ctggccgtggatgtgctcaacgccttgtataagcgcctaaaccaatggattgcgggcgat
ccctcgctgatgggggactatcgacgcgtgtgtacgtcgataggcgcggatgtgcgcgtc
gtgttgtcagaagataaggaactgcttggagtggctgagtctgtcaccgatgaaggcctt
atttgcgtgcgcgatgctagcggtgaactccatgaatttatggtcggtgacgtgacccat
ctgcgccttcaggataaataa

DBGET integrated database retrieval system