KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0662Help
Entry
DIP0662           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
639528..639992
Genome map
AA seq 154 aa AA seqDB search
MAGIRLQQGEEVRVDVTAPLTRLMLPVCELLLITGLCWMGIGFLDKSALDPNNDPTMRNG
VVLLWAVLSCWRFALPVVRARKERIIVTNQRIILRAPGLMGAKESIPFHAVRYIGRKRKN
ISLAVAGYSRPILLPNVAKAKYVVNEIEQHIGYR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggaattcgattgcagcagggggaagaagttcgcgtcgacgtcaccgcaccgctg
acacgtttgatgcttcccgtatgtgaattgctccttattactggactgtgttggatgggg
atcggcttccttgataagtcggcactagaccccaacaatgaccccaccatgcgcaatggt
gttgtgttgctgtgggctgtcttgagctgctggcgctttgcgctgccagtcgtgcgtgct
cggaaggaacgcataatcgttactaaccagcgaatcatcctgcgagcgccaggtcttatg
ggggcgaaagaatcgattccgtttcacgccgtgcgctatatcgggcgcaaaaggaaaaat
atatccttggccgtggctggttattcccgccccattcttctacccaatgttgccaaggct
aaatatgtagtcaacgaaatagagcaacatattggctatcggtaa

DBGET integrated database retrieval system