KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0664Help
Entry
DIP0664           CDS       T00151                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase catalytic subunit
  KO
K01588  
5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DIP0664 (purE)
Enzymes [BR:cdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     DIP0664 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
641251..641751
Genome map
AA seq 166 aa AA seqDB search
MTPLVGLIMGSDSDWPTVEPAAEVLAEFGIPFEVGVVSAHRTPEKMLAYAKTAHERGLKC
IIACAGGAAHLPGMVAAATPLPVIGIPRALKELDGMDSLLSIVQMPGGVPVATVSIGGAK
NAGLLAARILGAGDPELVTKMADYQENMRQEVERKDANLKKKLMGE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacaccactcgtaggccttatcatgggctccgactccgactggcccaccgttgaacca
gccgccgaggtactcgccgaattcggcatccccttcgaagtaggcgtagtttctgcacac
cgtactccagagaaaatgctggcatacgcaaaaaccgcacatgagcgcggtctaaaatgt
atcattgcctgcgccggcggtgccgcacacctacctggcatggtcgcagcagccaccccg
ctacccgtcatcggaatcccacgcgctctcaaagaactcgacggcatggattctctgctc
tccatcgtccaaatgccaggcggggttcccgttgctaccgtctccattggaggcgctaaa
aacgcaggactgttggccgcacgaattcttggcgccggtgatccagaactagtaaccaag
atggctgactaccaagaaaacatgcgccaagaagttgagcgcaaagatgccaacctcaag
aagaaattgatgggcgagtaa

DBGET integrated database retrieval system