KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0669Help
Entry
DIP0669           CDS       T00151                                 

Definition
(GenBank) Putative hydrogenase maturation protein
  KO
K04656  
hydrogenase maturation protein HypF
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(644718..646952)
Genome map
AA seq 744 aa AA seqDB search
MLRTRYLLRGVVQGVGFRPHVAAVAARHRITGLCGNNDLEVFVEAQALSEDILDAFISDV
LATLPPLAHVVTVTQSSCPPISHETDFRIVASEHLPGARTLIPPDVATCPDCLADMADPN
NRRYRYPFTTCTHCGPRLSIIEDLPYDRPLTTMKHFPMCPQCAKEYSDPHDRRYHAQPIS
CPDCGPSLWVEATETPGRPPLRLRVDDPIAYCRDAISKGKIVAVKGLGGFHLMCDATNDE
AVRTLRERKHRPTKPLAVMIPDVEKARELARLDADTTAVLTDPAHPIVLVPTTSKQRLKL
SLLIAPGLDYVGLVLPYTPLHTLLVDSPVVATSANNSGEPLCWDNDVARENLTHLADVFL
MHDRPIHIPVEDSVVVPSAHGIVPIRRSRGFAPLPLTIPTFAEAGQPALSTLAVGGELKN
TFTLAHEDYAHISSHIGDMGSWPSQQAFHRAVDQMLSMQRTRPDLLVCDLHPSYATTAWA
QRYSESNDIPLVQVQHHEAHAMALLAEHRACGTPAVILAADGTGYGHDNTIWGGELLSYH
PDTGFERTWHVPTFELVGGDRAVQHPWRIAAGIAHAWGLDWDCGKESSILSHTSAAEIEL
VESQLSSGFGVVRTSSLGRVFDAAAAIVGIHPPSFEAESAMLFEAAARNCEKRESEATSF
PEAFAELLETRNPWTFHHAVAQILQHHIDEAAVGMSTGLTGGCALNQLLSSMLRVDMRHQ
IVPPNDGGLSLGQAVLGRWTVSTA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcactcgataccttctcaggggtgtagttcagggggtaggctttcgcccccac
gttgccgccgtcgccgcccgtcatcgcataactggcttgtgtggcaacaacgatcttgag
gtgtttgtcgaggcccaagccctatccgaggacatcctcgatgcattcatttccgacgtg
ctcgccaccctcccaccactcgcacacgtggtaaccgtcacgcagtcatcatgcccaccg
atcagccacgaaacagacttccgcatcgtcgcatccgagcatctccccggcgcgcgcaca
ctgatcccacccgatgttgcgacctgccctgattgtttggcggatatggcggatccaaac
aatcgccgttatcgctacccttttacaacgtgtactcattgtggaccgcgtttgagcatc
attgaggaccttccctatgaccgaccgctaacaacaatgaagcatttccccatgtgcccg
cagtgcgccaaggagtattccgatccgcacgatcgccgctatcatgcccagccaattagc
tgccctgattgcggtccgtcgttgtgggtagaggctactgaaacgcctggcaggccaccg
ctacgcttgcgtgtcgacgaccccatcgcttactgccgtgacgcgatctcgaagggaaag
attgtagccgttaagggcctaggcggattccatctcatgtgcgacgcaaccaatgacgaa
gcagtgcgaacgctgcgcgaacgtaagcatcgccccacaaaaccgctggccgttatgatt
cccgatgtggaaaaagcccgtgagctagccagattagatgccgataccacggcggtgctt
actgatcccgcgcatcccatcgttttagtgcccacgacaagcaagcaacgcctcaaactc
agcctactcattgctccaggcttggactatgtaggactcgtgctgccctatacaccactg
catacgctcttggttgactcccctgtcgtagcgacttctgccaataactccggcgagccc
ctgtgctgggataatgacgtagcgcgcgagaatctgacgcatcttgccgatgtgttcctc
atgcacgatcgcccgattcatattcctgtggaagattcggtggtcgttcccagcgcacac
ggcattgttcccattagacgatcgcgggggtttgccccactgccactgacgattcccact
tttgccgaagctggccaaccggcactgagcacgctcgcagtcggtggagaactaaaaaac
acttttacccttgctcacgaagactacgcacatatctctagccacattggggatatggga
tcgtggccaagccagcaggcgtttcatcgcgcagttgatcaaatgctgagcatgcagcgc
acccgccccgacttgttggtctgcgatcttcatcccagctatgccaccaccgcttgggca
cagcgctatagcgaatccaacgatattccgcttgttcaggttcagcatcatgaagcccat
gcgatggcgcttcttgctgaacaccgcgcatgtggtacaccagcggtcattctggccgca
gacggcaccggctatgggcacgacaatacgatctggggtggcgagcttctttcctatcat
cctgatactggattcgagcgcacgtggcacgtccccacctttgaacttgttggtggcgat
cgcgcggtccagcatccgtggcggatcgcagcaggcatcgcgcatgcgtggggtctggac
tgggattgtgggaaagaatcgtcgattctttcccacacatctgcggcagagatcgaacta
gtagaaagtcagttgtcgtctggctttggcgtggtgcgtacaagttcgctgggccgtgtg
tttgatgctgcggctgcaatcgtggggattcacccgccgagttttgaggcggagtcagcg
atgttgttcgaggctgcggctagaaattgcgagaaacgagaatcagaggcgacgtcgttt
ccggaggcatttgcggaacttcttgagactcgaaacccgtggacgtttcatcatgcggta
gcgcagattcttcagcaccacatcgatgaggctgcagtcggcatgagtaccggtcttact
ggtggttgcgcattgaatcaactgttgtcgagcatgttgcgcgttgatatgcgccatcaa
attgtgccgccgaatgatggcgggttaagcctcggccaggcggtgctgggacgttggact
gtgagcaccgcctag

DBGET integrated database retrieval system