KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0671Help
Entry
DIP0671           CDS       T00151                                 

Definition
(GenBank) Putative hydrogenase nickel incorporation protein
  KO
K04652  
hydrogenase nickel incorporation protein HypB
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Chaperones and folding catalysts [BR:cdi03110]
 Other chaperones and cochaperones
  Others
   DIP0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
647316..648077
Genome map
AA seq 253 aa AA seqDB search
MGRFHRHDDGTVHSHDHDHHGHSHDVGDHSGYETGRERIEVLEDIFHENDHCAADNKELF
DAHQVRCINIMSSPGAGKTTVLQHVLRAAEGKVRVGVVEGDIETSLDADRLTGFGAQISL
LNTGNGFGGECHLDAPMVSRALRGLDLDTLDVVLIENVGNLVCPAEFEVGEHSKAMIYSV
TEGEDKPLKYPVMFRSVDAVVINKIDLLPYLDFDMELFMKNLRQVNPDAKVFEVSAKTGE
GLDGWIEWLVGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggggcgttttcatcgccacgacgacggtacggtgcattcccacgaccatgaccaccac
ggtcattctcatgatgttggggatcactccggttacgaaactgggcgggagcgcattgag
gtcctagaggatattttccacgaaaacgaccactgcgctgcggataacaaggagcttttc
gacgcccaccaggtgcgttgcatcaacatcatgagctcgcctggtgcaggtaaaaccacg
gtgttgcagcatgtattgcgagctgctgaaggaaaagtgcgcgtaggtgttgttgaaggc
gacattgaaacttccctagacgcagatcgtctcactggctttggtgcccagatttcattg
ctgaacactggcaatggttttggtggagagtgccacctcgatgcccctatggtgagccgt
gcgcttcgtggcctagaccttgacaccctcgacgtggtgctcattgaaaacgtgggcaac
ttggtgtgccctgcggaatttgaagtcggtgagcacagcaaagcgatgatctactcggtc
acggagggggaagataagcctctgaagtaccctgtgatgttccgtagcgtggatgcagtc
gtgattaacaagatcgacttgctgccatatttggattttgacatggagctttttatgaag
aatctgcgccaagtcaatcccgacgccaaagtgtttgaggtttctgccaagacgggtgaa
ggactcgacggctggattgaatggttggtcggggccaaatag

DBGET integrated database retrieval system