KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0675Help
Entry
DIP0675           CDS       T00151                                 

Definition
(GenBank) Putative hydrogenase maturation protease
  KO
K03605  
hydrogenase maturation protease [EC:3.4.23.-]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     DIP0675
Peptidases [BR:cdi01002]
 Aspartic Peptidases
  Family A31: HybD endopeptidase family
   DIP0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
652547..653059
Genome map
AA seq 170 aa AA seqDB search
MITVIGVGNPVMGDDGAGLAVLRRLQGITNDLDWVPRLSTSDPAAPNYIDGGTSGMELLP
IVQDADKLLLLDAVTGPGAPGDVVRLHGDQIPRLLSSRLSPHQVGLLDLLSAARLLGREP
NEVAVVGIVVEHCDLHVGLSQAVTDAIETATDAARDVIAEWQRLEAAHAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacagtaatcggagtaggaaacccagtcatgggagacgacggcgcaggcctcgca
gttttgcgccgtctccaaggcattaccaatgaccttgactgggttccgcgactatccaca
tccgaccccgccgcccccaactacatcgacggcggcacctccggcatggaattgctcccc
atagtccaagacgcagacaaacttctgcttctcgacgccgtcacaggtccaggcgcgcca
ggcgatgttgttcgcctccacggcgaccagatcccacgtctgctgagctcacggctatcc
ccacaccaagtaggtctgctcgacctgctttctgcagcacgccttcttggccgtgaaccc
aacgaggtagcagtagtgggaatcgtcgtcgagcactgcgaccttcacgtaggcctcagc
caagcagtaacagacgctatcgaaaccgccaccgacgcagcccgagacgtcatcgctgaa
tggcaacgtctcgaagccgcccacgcgaattaa

DBGET integrated database retrieval system