KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0680Help
Entry
DIP0680           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(655425..656903)
Genome map
AA seq 492 aa AA seqDB search
MLLSLLSALVLIVSAAGYFTVGRIGNTVASAGNLVLGGDKGMKEAADGATDILLVGSDSR
TDAQGNPLTPEEIELLHAGDEENDNTDTLMVIRVPNDGSSATAISIPRDTYVHDENVGNL
KINGVYRAYKNRKASELVNSGESDQKHIDELSKEAGRKALISSISDLTGVTVDHYAEVGL
LGFVLLTNAVGGVDVCLNNDVYDEFSGADFKAGQQTLRDGQALAFVRQRHGLPRGDLDRI
VRQQAFMASLVAKVLSSGTLTNPSKLSDLGEAVSRSVVIDKNWDVMSFANQLQNLAGGNV
KFNTIPVTSIDGVGDYGESVVTVDKNQVHQFFDRLLNGNNGEETPTSDSEAPAENPHTST
TIDVLNATSTTGLASQVAGHLSAKHYTIGNIGNALEGMYHESQIVAADPNNEAVKAIAAE
LGGLPITQRNDLDADSVVVVIASDYSGPTGDGAESSDSSSSTTTVGKPGSDEGEAIVSPE
IDAGGQGPRCVN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgtccttattatctgccttagtgctgatcgtctcggcagctggttatttcact
gttggacgaatcggcaacacggtcgcttctgccggcaacctcgtactcggcggcgataaa
ggcatgaaagaagctgccgacggcgccaccgacatcctgcttgttggctccgactcgcgt
acggatgcccagggtaatccgctcactccggaagaaatcgagttgttgcacgcaggcgac
gaggaaaacgacaacaccgacaccctcatggttattcgcgtgcctaacgacggctcctct
gccaccgcgatctcaattcctcgtgacacctatgtgcatgatgaaaacgtgggcaacctc
aagatcaatggtgtctaccgcgcctacaaaaaccgcaaagcttccgaactagtcaatagt
ggggaaagcgatcaaaagcacattgacgaactatccaaggaagctgggcgcaaggctctc
atctctagcatctccgatctcactggtgtcaccgttgaccattacgcagaagtaggcctc
ctcgggttcgtactgctcaccaatgctgttggtggcgtcgacgtttgtcttaacaacgac
gtttacgatgagttttctggtgcagacttcaaagccggccaacaaaccctacgcgacggt
caagctctcgcattcgttcgccaacgccacggtctaccacgtggtgaccttgatcgtatt
gttcgccagcaagcgtttatggcatcgcttgttgccaaagttctttcttcgggcacactg
accaacccatccaagctctccgatctaggtgaggcagtatctcgctccgtggtgatcgat
aaaaactgggatgtgatgagttttgccaaccaactccaaaacttggccggtggcaacgtt
aaattcaacaccatccccgtgacatccattgatggcgtaggcgattatggcgaatccgta
gtcaccgtggataaaaaccaagtccaccaattcttcgatcgcctcctcaacggcaacaac
ggcgaagaaaccccaacctcggatagcgaagcaccggcagaaaacccccacacgtccacc
actatcgacgtgctcaatgccaccagcaccaccggtcttgcttcgcaagtagcaggccat
ctctccgcaaagcactacaccatcggcaacatcggcaatgcattagaaggcatgtaccac
gaaagccaaattgttgccgccgacccaaacaatgaagcagtcaaggctattgccgccgag
ctcggaggcctacccattacccagcgcaatgacctagatgccgattccgtcgtcgttgtt
atcgcatccgattattctggcccaaccggcgatggcgcagaatcatctgactcttctagt
agcaccaccaccgttggcaagcctggcagcgacgaaggcgaagcaattgtctcccctgaa
atcgacgccggtgggcaaggacctcgctgcgtgaactag

DBGET integrated database retrieval system