KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0682Help
Entry
DIP0682           CDS       T00151                                 

Definition
(GenBank) Putative mannose-1-phosphate guanyltransferase
  KO
K00966  
mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIP0682
   00520 Amino sugar and nucleotide sugar metabolism
    DIP0682
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DIP0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
658206..659294
Genome map
AA seq 362 aa AA seqDB search
MTETTLRSDTDAVILVGGKGTRLRPLTVSTPKPMLPTAGVPFLSHLLARIKAAGITHVVL
GTSFKAEVFEDYFGDGADLGLEIEYVVEDKPLGTGGGIRNVYDKLRANTVMVFNGDVLGG
TDLGGILDAHHAKNADLTMHLVRVPDPRAFGCVPTDAEGRVSAFLEKTEDPPTDQINAGC
YVFRRELIGEIPADRVVSVERETFPRLLEEGRRVFGYVDNAYWRDMGTPSDFVRGSSDLV
RGIAPSPLLEGKTGECLVDESAGVSDGALLLGGTVIGRGTEIGAGCRLDDTVVFDGVTIE
PGAVIEDSIIGHGARIGANARITGCVIGEGAEIGARCELRDGMRVWPGVVIPTAGIRFSS
DA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacaacactgcgcagcgacacagatgctgtgatccttgttggaggtaagggc
actaggttgcgtccgctgactgtgtcgactccaaagcccatgctgcctacggcaggtgtg
ccgttcctttcgcatttgcttgcgcgtatcaaggctgccggtatcacgcatgtggtgctg
ggtacgtcgtttaaggcggaggtgtttgaggactacttcggtgatggtgctgatctcggc
ttggagattgagtacgtggtggaggataagccattgggtaccggtggcggcattcggaac
gtgtatgacaagcttcgtgctaacaccgtgatggtgtttaacggcgatgttcttggcggc
actgatcttggtggaatccttgatgctcaccatgccaaaaacgctgatttgaccatgcat
ttggtacgagttccagatcctcgtgcgtttggttgtgtgcccactgatgctgagggacga
gtttctgctttcttggaaaagaccgaggatccaccaacggaccagattaatgctggttgc
tatgtgttccgtcgtgagctgatcggtgagatccctgcagatcgagtggtgtctgtggag
cgcgagactttcccacgcttgctggaggagggacgccgcgtgttcggttatgtagacaat
gcatattggcgcgacatgggtactccttctgacttcgtgcgtggttcgtcagatttggtt
cgtggtattgcgccgtcgccgttgttggaaggtaagacgggggagtgccttgtcgacgaa
tccgctggtgttagcgatggtgcgttgcttttgggcggtaccgtgattggtcgcggcact
gaaatcggtgcgggctgtcgtttggacgacaccgtggtgtttgatggtgtgaccattgag
ccgggtgctgtgattgaagattcgattattgggcatggtgctcgtattggagccaatgct
cgcattaccggctgtgtgattggtgaaggcgcggaaatcggtgcacgttgtgagcttcgc
gacggcatgcgtgtgtggccaggagttgtgattccaactgctggtatccgttttagttcg
gatgcctaa

DBGET integrated database retrieval system