KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0682Help
Entry
DIP0682           CDS       T00151                                 

Definition
(GenBank) Putative mannose-1-phosphate guanyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00051  Fructose and mannose metabolism
cdi00520  Amino sugar and nucleotide sugar metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIP0682
   00520 Amino sugar and nucleotide sugar metabolism
    DIP0682
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DIP0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954 Fucokinase Hexapep_2
Motif
Other DBs
NCBI-ProteinID: CAE49199
UniProt: Q6NIT4
Position
658206..659294
Genome map
AA seq 362 aa AA seqDB search
MTETTLRSDTDAVILVGGKGTRLRPLTVSTPKPMLPTAGVPFLSHLLARIKAAGITHVVL
GTSFKAEVFEDYFGDGADLGLEIEYVVEDKPLGTGGGIRNVYDKLRANTVMVFNGDVLGG
TDLGGILDAHHAKNADLTMHLVRVPDPRAFGCVPTDAEGRVSAFLEKTEDPPTDQINAGC
YVFRRELIGEIPADRVVSVERETFPRLLEEGRRVFGYVDNAYWRDMGTPSDFVRGSSDLV
RGIAPSPLLEGKTGECLVDESAGVSDGALLLGGTVIGRGTEIGAGCRLDDTVVFDGVTIE
PGAVIEDSIIGHGARIGANARITGCVIGEGAEIGARCELRDGMRVWPGVVIPTAGIRFSS
DA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacaacactgcgcagcgacacagatgctgtgatccttgttggaggtaagggc
actaggttgcgtccgctgactgtgtcgactccaaagcccatgctgcctacggcaggtgtg
ccgttcctttcgcatttgcttgcgcgtatcaaggctgccggtatcacgcatgtggtgctg
ggtacgtcgtttaaggcggaggtgtttgaggactacttcggtgatggtgctgatctcggc
ttggagattgagtacgtggtggaggataagccattgggtaccggtggcggcattcggaac
gtgtatgacaagcttcgtgctaacaccgtgatggtgtttaacggcgatgttcttggcggc
actgatcttggtggaatccttgatgctcaccatgccaaaaacgctgatttgaccatgcat
ttggtacgagttccagatcctcgtgcgtttggttgtgtgcccactgatgctgagggacga
gtttctgctttcttggaaaagaccgaggatccaccaacggaccagattaatgctggttgc
tatgtgttccgtcgtgagctgatcggtgagatccctgcagatcgagtggtgtctgtggag
cgcgagactttcccacgcttgctggaggagggacgccgcgtgttcggttatgtagacaat
gcatattggcgcgacatgggtactccttctgacttcgtgcgtggttcgtcagatttggtt
cgtggtattgcgccgtcgccgttgttggaaggtaagacgggggagtgccttgtcgacgaa
tccgctggtgttagcgatggtgcgttgcttttgggcggtaccgtgattggtcgcggcact
gaaatcggtgcgggctgtcgtttggacgacaccgtggtgtttgatggtgtgaccattgag
ccgggtgctgtgattgaagattcgattattgggcatggtgctcgtattggagccaatgct
cgcattaccggctgtgtgattggtgaaggcgcggaaatcggtgcacgttgtgagcttcgc
gacggcatgcgtgtgtggccaggagttgtgattccaactgctggtatccgttttagttcg
gatgcctaa

DBGET integrated database retrieval system