KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0789Help
Entry
DIP0789           CDS       T00151                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DIP0789
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DIP0789
   00650 Butanoate metabolism
    DIP0789
  Lipid metabolism
   00071 Fatty acid degradation
    DIP0789
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DIP0789
   00310 Lysine degradation
    DIP0789
   00360 Phenylalanine metabolism
    DIP0789
   00380 Tryptophan metabolism
    DIP0789
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DIP0789
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DIP0789
   00281 Geraniol degradation
    DIP0789
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DIP0789
   00627 Aminobenzoate degradation
    DIP0789
   00930 Caprolactam degradation
    DIP0789
Enzymes [BR:cdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DIP0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
769931..770707
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTVNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccgtaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgaccttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgatctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggtggt
tgggcgcgatcaattttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcacccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtgtttactggtcgctga

DBGET integrated database retrieval system