KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0826Help
Entry
DIP0826           CDS       T00151                                 

Definition
sulfite synthesis-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DIP0826
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DIP0826
Transfer RNA biogenesis [BR:cdi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DIP0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(798546..799304)
Genome map
AA seq 252 aa AA seqDB search
MTAQFDDATLTKRLAKGTGEILKGVRNVGLLRGRELGEAGDDLAQNWIARVLEQHRPDDG
FLSEEAADNPERLGKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGVPTHAAVNLPDLG
VVFHSSEVRAVGGPYAKKIAISHNRPPAVATHIAESLGFTAEPMGSAGAKAMHVLLGDYD
AYIHAGGQYEWDSAAPVGVSLAAGLHCSRLDGTPLNYNNKDTYLPDVLICRPELADDILT
MAAAFREENGSY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtttgacgatgcaacacttaccaagcgactagccaaaggcacaggcgag
atcctcaaaggagtgcgcaacgtgggtcttctccgcggacgcgaactcggcgaagccggc
gacgatctcgcacaaaactggatcgcccgcgtactcgagcagcaccgccccgacgacggc
ttcctctccgaagaagcagccgataacccagaacgcctcggcaaagatcgcgtatggatt
atcgaccccctcgatggcaccaaagaatttgccaccggccgccaggactgggctgttcac
atcgcacttgtagaaaacggcgtacccacccacgctgccgttaaccttcccgaccttggc
gtggtattccactcctccgaggttcgcgcagtaggcggcccctacgccaagaagatcgct
atctctcacaaccgcccaccagcggtagccacccacatcgcggaatccttaggcttcacc
gcagaacccatgggatccgctggtgcaaaggccatgcacgtactgttgggcgactacgat
gcctacatccacgcaggtggacagtacgagtgggactccgcggccccagtgggcgtgagc
ctcgccgcaggtctgcactgctcgcgtctcgacggcaccccgttgaactacaacaacaaa
gacacgtatcttccagacgtactgatctgccgccccgagcttgccgacgacatcctcacc
atggccgcagctttccgtgaggagaacggctcctactaa

DBGET integrated database retrieval system