KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0849Help
Entry
DIP0849           CDS       T00151                                 

Gene name
rpsN
Definition
(GenBank) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi03010  Ribosome
Module
cdi_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    DIP0849 (rpsN)
Ribosome [BR:cdi03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    DIP0849 (rpsN)
  Bacteria
    DIP0849 (rpsN)
  Archaea
    DIP0849 (rpsN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S14 HTH_17 Con-6 DUF148
Motif
Other DBs
NCBI-ProteinID: CAE49365
UniProt: Q6NIC8
Position
complement(825815..826120)
Genome map
AA seq 101 aa AA seqDB search
MAKKSKIAKNEQRKEVVARFAERRNELKAIIKNPNTSDEDRLDAQFELNRQPRDASPVRV
RNRDSRDGRPRGFLRKFGVSRVRMREMAHRGELPGVRKSSW
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagtccaagatcgccaagaatgagcagcgcaaggaagtcgtcgcccgcttt
gcggagcgccgtaacgagctcaaggcaatcatcaagaacccgaacacctctgatgaggat
cgtctcgatgcacagttcgaattgaaccgccagcctcgtgacgcttccccagttcgcgtc
cgtaaccgtgactcccgcgatggtcgcccacgtggcttcctgcgtaagttcggtgtttcc
cgtgtccgcatgcgcgagatggctcaccgcggtgagcttccgggcgtccgtaagtccagc
tggtaa

DBGET integrated database retrieval system