KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0982Help
Entry
DIP0982           CDS       T00151                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
953662..954759
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHYEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYHAQEMLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPEGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNS
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacgaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccattacgaaaagaacatagccgacgccatcgagcaagctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcgtacccatcgaggactagga
gaaagagtaatcctcgccggccacatcgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccggcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacgggctggggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccttccggcgct
gtgatcgaagctggatgccaaggaacgattcgtttgcgcgtcaccgcccatggtgtgcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacagtaccacgcccaagaaatgcttgtcgacggctgcctctaccacgag
ggcctcaacatcgtgcattgcgaatctggggttgccacgaacactatccccgatgaggcc
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctacccgagggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaattcc
cagacgacaggagcctga

DBGET integrated database retrieval system