KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1088Help
Entry
DIP1088           CDS       T00151                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DIP1088 (pfkA)
   01230 Biosynthesis of amino acids
    DIP1088 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DIP1088 (pfkA)
   00030 Pentose phosphate pathway
    DIP1088 (pfkA)
   00051 Fructose and mannose metabolism
    DIP1088 (pfkA)
   00052 Galactose metabolism
    DIP1088 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    DIP1088 (pfkA)
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DIP1088 (pfkA)
Protein phosphatases and associated proteins [BR:cdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DIP1088 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1070298..1071326
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEGTMDFVEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacactcaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggactacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacaccacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgccgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcattgcctaaggaaggcacgatggactttgtcgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttgggtcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcatgccgcacgtgcgtgccacaac
ggcgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtcccggaaggacgctaccgcacagcacgcgccctg
tttggctaa

DBGET integrated database retrieval system