KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1376Help
Entry
DIP1376           CDS       T00151                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DIP1376 (ruvA)
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DIP1376 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1394044..1394655)
Genome map
AA seq 203 aa AA seqDB search
MIVSLRGTVESIGLGSAVIECNGVGYEVLAAPTTLGRLTRGEQARVLTTMVVREESQTLY
GFTDDASRRMFVLLQSVSGLGPKLALAAQSVFTTEDIARHIAGGDAKALQKIPGVGKRMA
ERMIVDLKDKVVGFNDGIPAAAQPQLSIAVDQAVQEQVLEALVGLGFSEKIALPVLSRVL
RDSPELSKSQALRAALSELGTKN
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtttctctgagaggtacagtcgaatcgatcggtttaggtagcgctgtaatcgaa
tgtaatggcgtaggttatgaggtgctagctgcccccacaactcttggacggttaactcgg
ggagagcaggcgcgggtgttaaccacaatggtggtcagggaggaatcccaaacattgtat
gggtttaccgacgatgcttcacgacgcatgtttgttctgttgcagtcggtatcgggctta
ggtcctaaacttgccttagcagcacagtctgtttttactacggaagacatcgctcgacat
atcgctgggggtgatgccaaggctttgcagaagattcctggagtcggtaaacggatggct
gaacgcatgatcgttgatctaaaagataaagttgttggattcaatgacggtattcctgct
gccgcacagcctcagttgtccattgccgtcgatcaagcagtccaagagcaagtacttgaa
gctctcgtaggactagggtttagtgaaaaaattgcattgccagtgttgtctcgtgtgttg
cgggactccccagagctctcaaaatctcaagcattgcgcgcagcattaagcgaattgggc
actaagaactaa

DBGET integrated database retrieval system