KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1414Help
Entry
DIP1414           CDS       T00151                                 

Gene name
dtxR
Definition
diphtheria toxin repressor
Orthology
K03709  
DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
1431335..1432015
Genome map
AA seq 226 aa AA seqDB search
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR
SLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVL
KDVSRSPFGNPIPGLDELGVGNSDAAVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFT
QLLDADIRVGSEVEIVDRDGHITLSHNGKDVELIDDLAHTIRIEEL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttagtcgataccacagagatgtacttgcgtactatctatgagctggaagaa
gagggtgtcacccctcttcgcgctaggatcgctgagcgtctggaacaatctggacctaca
gttagccaaaccgttgcccgtatggagcgcgatggacttgtcgttgtcgcctcagaccgc
agtctacaaatgacaccgacaggccgcactttagcgactgcagttatgcgtaaacatcgc
ttagctgagcgccttcttaccgatatcattggcctagatatcaataaagttcacgatgaa
gcctgccgctgggaacacgttatgagtgacgaagttgaacgcaggctcgtgaaagtattg
aaagatgtcagtcggtcccccttcggaaacccaattccaggtctcgacgaactcggcgta
ggcaattctgacgcggcagtccccggaactcgcgttattgacgctgccaccagtatgccc
cgcaaagtacgcattgttcagataaatgaaatcttccaagttgaaacggatcagtttaca
cagctcctcgatgctgatatccgagttggatcagaagttgaaattgtagatagagacggc
cacatcacgttgagccacaatggaaaagatgtcgaacttatcgatgatctggcccacact
attcgtatcgaagaactctaa

DBGET integrated database retrieval system