KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1555Help
Entry
DIP1555           CDS       T00151                                 

Gene name
trpC2
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DIP1555 (trpC2)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DIP1555 (trpC2)
Enzymes [BR:cdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DIP1555 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1584186..1584998)
Genome map
AA seq 270 aa AA seqDB search
MAMVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEIKR
AAPGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRD
FIVDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALD
AGARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVV
IGQSIVTAQSPRGATRALVAAGQHPSCPSR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctatggttacagtcttcgatgagatcatcgctggtgttgtggaagacgttgccgcg
cgcgaagcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacct
agggatgcttgtggggcattgttagcaagtggctgtggaatcatcgcggagatcaaaagg
gcagcacctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgag
ctcgagtccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatggt
tctttgacggagatggcaaagattcggcgtcacgtgtccgttccagttatgtgtcgcgat
tttattgttgatccctatcagattcatgaagctcgctgctatggagctgatatggtgccg
cttcgggtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggagtcc
ctggggatggctgcgcttgtcgaggtacgcgatactgcggaggcatctcgtgccttagat
gctggtgcccgaattatcggcgttaatgcgagagatttttctacgatgacccttaaccga
gcggctttttgcgagatcgctccaggacttcctagcgacgtggtccgagtggcgctttca
ggggttcgtaatgctaaagagcttttagactacgcctcggctggggcagacgccgtggtg
attggccaaagcatcgtgacggcgcaatcgcctcgaggggcgacgcgtgccttggttgct
gcaggccagcatccctcgtgtccctcacgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system