KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1639Help
Entry
DIP1639           CDS       T00151                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DIP1639 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DIP1639 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    DIP1639 (aceF)
Enzymes [BR:cdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DIP1639 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1673085..1675034
Genome map
AA seq 649 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDAVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAEAPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEAADSTDVVMPELGESVTEGTITQWLKS
VGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVGTPGSAPAA
KEEPAKEPKAETPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLADKHGVDLTT
VEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLIGTTQKVNRI
REITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLPFFAKAIVE
ALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPELAKAIVDL
ADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKRPVVITEDG
IDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacgcggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagccagcagaggagccaaaagctgaggcaccaaaggct
gaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatcctc
gaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagcagccaaggaagagccagccaaggagccaaaagccgagaca
ccaaaggaagagccaaaagctgaggcaccaaaggctgaagcagctgactccaccgacgta
gtcatgcctgaactcggcgagtccgtcaccgaaggcaccatcacccagtggctgaagtcc
gttggcgacaccgtcgacgttgacgaaccactcctcgaagtctccaccgacaaggtcgac
accgaagtcccatccccagtcgctggcaccatcctcgaaatcctcttcaacgaagacgac
accgtcgacgtcggagacgtaatcgttcgcgttggcaccccaggatctgctccagcagcc
aaggaagagccagccaaggagccaaaagccgagacaccaaaggaagagccaaaagctgag
gcaccaaaggctgagccaaagaaggaagctcctgccaagaccatcaacaacgagaacgtc
ccttacgtcactccgctggtccgcaagctggctgacaagcacggcgttgatctgaccact
gttgaaggcactggtattggtggacgcatccgcaaacaggatgttttggctgctgctggc
gttggcgcagcccctgcagcacaggttgctcctgcccagccagtttctgcagcatccacc
aagtccgtggatccagagaagcagaagctgatcggtacaactcagaaggtcaaccgtatc
cgagagatcaccgcgcgcaagactgtggaggctttgcagatttctgctcagctcacccag
ctgcatgaggtcgatatgactaaggttgcggaactgcgtaaggccaacaagccagccttc
caagaaaagcacggtgtgaacctcacctacttgccattctttgcaaaggcaattgttgag
gctttggttgctcacccgaacgtcaatgcgtcctacaacgctgagacaaaggagatgacc
taccacgctgatgtcaacctctccatcgccgttgacaccccagctggtctgcttacccct
gttatccacaaggctcaggagttgtccttgcctgagctcgctaaggcaattgtcgatttg
gctgaccgtgctcgtaacaacaagctcaagccgaatgatctttccggtggcaccttcacc
attaccaacattggttctgagggcgctctcagcgataccccaatcttggttccaccacag
gcaggtatcttgggtaccggcgctattgttaagcgtccagtagtcatcacggaagatggc
atcgattcgattgctattcgccagatggtctacttgccacttagctacgatcaccagatc
gtcgatggtgccgatgcaggtcgtttcttgaccaccatcaaggatcgccttgagactgca
aacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system