KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1666Help
Entry
DIP1666           CDS       T00151                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00260  Glycine, serine and threonine metabolism
cdi00750  Vitamin B6 metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
cdi01120  Microbial metabolism in diverse environments
cdi01230  Biosynthesis of amino acids
Module
cdi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP1666 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DIP1666 (thrC)
Enzymes [BR:cdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DIP1666 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: CAE50195
UniProt: Q6NG64
Position
complement(1701262..1702710)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDASSTPAHFTDILLGGLAPDGGLYLPEQYPQLTEELLEQWRTLLEDKGYAALA
AEVLKLFIDDISAADIEKITARAYTTPKFSDEDIVPVTKLENNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELGRRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFVFDLLGRDAGRVADLFGVQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWACDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVSVVKDFIVTSIEETEK
TQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcaacacctgctcattttaccgatatcttg
cttggtggacttgcccccgatggtggtctttacctgccagaacagtatccacaactgacc
gaagagctgcttgagcagtggcgtacgttgttagaagacaaagggtatgcggcactcgct
gctgaagtattaaagctatttatcgacgacatctccgcggccgatattgaaaaaatcacc
gcccgtgcgtacaccacgcccaagttttctgatgaagacatcgttccagtgacaaaactg
gagaacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gcaatgcagttgctcggcgaacttttcgaatatgagctagggcgtcgcggcgaatccctg
aatatcctcggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtggc
cgaaaggggatccgcgtttttatgctcacccctgcgggacgtatgaccccattccaacag
gcacagatgttcggtcttgatgacccaaatatctttaatatcgcgctcgatggtgtattc
gacgattgccaagatgtagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcggtgaactccattaactgggcacgtcttgtagcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgatcaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtgctcgatgagtttttccgcaccggc
gattaccgtgtacgcagctctgcagatacgtatgaaacgtcttctccgtccatggacatt
tcgcgtgcttctaactttgaacgctttgtatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtgtacaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgcgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatacc
gcggacggtgtgaaagtagcacgagattgggcctgcgatattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaagcaacaggacgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacgtcgtgtaactgatctt
cctaatgacgtatcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
actcagtag

DBGET integrated database retrieval system