KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1726Help
Entry
DIP1726           CDS       T00151                                 

Definition
glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DIP1726
Enzymes [BR:cdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DIP1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1765812..1767980
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWAPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYTENPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDIAELAEKFTALNLTPEKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCADQELAVLESSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREDLGILTTDVA
NEYAEDLNWQADILNVVRNSGAFESIVPADFHGVDRADRGSSVELLSALHRFLAGTPSAL
TCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagactctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggaccaaatccgctacgccctacaacagcgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggcgatccctatgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactgggccccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgaccttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgataagtacacagaaaatcctgtcagcggtgttatggcacagctgtactctgctcgt
agtaagaattcttggggcatgggcgatttcaacgatctcggcctgctggctgagacgctc
gccccgcaggctgattatctgttgattaatcctctgcacgctgctgagccgatgccacca
gtggaggattccccatacttgcctactacgcggcgttttatcaacccgatttatatccgc
atcgaagatatccctgagcacttgcttctcgacgatgacctacaaaatgatatcgccgaa
cttgcggaaaagttcactgcccttaatctcacccctgaaaagattgagcgcaatccaatt
tttgatgccaagttgcaagtgctgcacgcggtattcaatgtagagcgcgaaccagcacgt
gaacaggacttccaagacttcatcgccaccgaaggccaaggcctacgcgacttcgcttca
tggtgtgccgaccaagaactagcagttttggagagctccgcagcacatgccgctcttccg
gaaaaagagtctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gcagtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccttagtcgcc
cgcgcttcggtaggtgcgccaccagatagctacaaccaccaaggccaagactggtcgcag
ccaccatggcacccagaccgcttggcagagtccggctatatcccatggcgtgacctgctg
cgcacggtgctgcgccacgccggtggtgtccgtgtagaccacattcttggtcttttccgc
ttgttctggattccacgtacgcagtctccacaaacgggtacttacgtcaactacgatcac
aacgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggttcaagacttccttgcatcccgaggcatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggcccacgcaagcagcatgag
tatcgccaattggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
cttgctggcgagcacattgcgttgcgtgaggacctcggaattttgaccaccgatgtagca
aatgagtatgccgaggatttgaactggcaggcagatatcctcaacgtggtccgtaactcg
ggcgcatttgagtccatcgtccctgccgatttccacggtgtagatcgtgctgaccgcggc
agctccgtcgaactgctttcggcgttgcaccgcttcttggctggtacaccatcagctctg
acctgcaccgcattggtggatcttgtcgccgataagcgcgctcaaaaccagccgggcact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system