KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1925Help
Entry
DIP1925           CDS       T00151                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cdi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cdi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1978463..1978933)
Genome map
AA seq 156 aa AA seqDB search
MSILDTEVTLINGEKASMDQWAGHCLLIVNTASECGYTPQLETLEELYEDYAMRGFFVIG
VPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSDVNGPNTIELYKKLKGDGPDIEWNF
EKFIVAPSGEVVGRFAPSLDPDDMKIINVLEEYLPI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttagataccgaggtcacgctgatcaacggcgagaaagcctcaatggatcag
tgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggctataccccgcag
ctggagacgctggaagagctttatgaggattatgcgatgcgtggtttcttcgtaatcggt
gttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcaggtggcgcgtcga
tacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggacgtcaatggcccc
aacactattgagctgtataagaagctcaagggtgatggtccagatattgagtggaacttt
gaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcgccctcgcttgat
cctgacgatatgaagatcattaacgtcttagaagagtatcttcctatctaa

DBGET integrated database retrieval system