KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1999Help
Entry
DIP1999           CDS       T00151                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DIP1999
Enzymes [BR:cdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DIP1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2047150..2047986)
Genome map
AA seq 278 aa AA seqDB search
MSAKDLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAANAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRASRGLQSGPVDAD
PATAAVTAIAAHMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgaaagacctcatcattcccgagcgaacagccgtcatgggcattgtgaacgtc
accgaagactcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggcggcgaatccacccgc
ccaggtgccacccgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctatccgaagaaggcatcgccacctccatcgacaccatgcgcgccagtgttgccgcc
gcagcagccaacgccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtactccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcagacgta
caccagaccctagataagctggtcacctctgcactcaacgccggtgtcaaagaagacaac
atcaccatcgacccaggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgcctcccgaggcctgcaatcagggccagtcgacgccgac
cccgccaccgcagcggtgacagcgatcgccgcacacatgggagcatggtgcgtgcgcgtc
cacgaagtagcagtttcccgagacgcggtcgacgttgcggccctgtggaatgcgtga

DBGET integrated database retrieval system