KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2114Help
Entry
DIP2114           CDS       T00151                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DIP2114 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DIP2114 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    DIP2114 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    DIP2114 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DIP2114 (adhA)
   00626 Naphthalene degradation
    DIP2114 (adhA)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DIP2114 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2163769..2164809)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPTEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgcctttaccgccgctgttgtggacaagtttggctcc
gagctcaacatccacgacgttgaccttccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccacgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctgtggtcagct
tgtggcgagtgtgaatactgccgcaccggctgggagactatgtgtgagaaagccgagtac
ggtggatacaccgtcgatggctctttcggtcagtatatgctggtagatactcgctactgt
gcccgcatcccagacggctgtgacctgctggaagtcgccccaattttgtgcgctggcgtg
accgtgtacaaaggactcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggcggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaaaaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccaactgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
attttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system